Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282261_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse brain using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Doublecortin Polyclonal Antibody | anti-Doublecortin antibody

Doublecortin Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TDP2; EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Doublecortin, Antibody; Doublecortin Rabbit pAb; DBCN; DC; LISX; SCLH; XLIS; DCX; anti-Doublecortin antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP
Applicable Applications for anti-Doublecortin antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
SH-SY5Y, Jurkat (negative)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 265-365 of human Doublecortin (NP_835365.1).
Cellular Location
Cell projection, Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse brain using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282261_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse brain using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat brain using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282261_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat brain using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of SH-SY5Y cells using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282261_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of SH-SY5Y cells using Doublecortin Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Doublecortin antibody at 1:440 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA282261_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Doublecortin antibody at 1:440 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-Doublecortin antibody
This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, mental retardation, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
362
NCBI Official Full Name
Tyrosyl-DNA phosphodiesterase 2
NCBI Official Synonym Full Names
tyrosyl-DNA phosphodiesterase 2
NCBI Official Symbol
TDP2
NCBI Official Synonym Symbols
EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3
NCBI Protein Information
tyrosyl-DNA phosphodiesterase 2; VPg unlinkase; ETS1-associated protein 2; ETS1-associated protein II; tyr-DNA phosphodiesterase 2; 5'-Tyr-DNA phosphodiesterase; tyrosyl-RNA phosphodiesterase; 5'-tyrosyl-DNA phosphodiesterase; TRAF and TNF receptor associ
UniProt Protein Name
Tyrosyl-DNA phosphodiesterase 2
UniProt Gene Name
TDP2
UniProt Synonym Gene Names
EAP2; TTRAP; Tyr-DNA phosphodiesterase 2; hTDP2; 5'-Tyr-DNA phosphodiesterase; EAPII
UniProt Entry Name
TYDP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Doublecortin tdp2 (Catalog #AAA282261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Doublecortin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Doublecortin can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the Doublecortin tdp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELGSCLEGG REAAEEEGEP EVKKRRLLCV EFASVASCDA AVAQCFLAEN DWEMERALNS YFEPPVEESA LERRPETISE PKTYVDLTNE ETTDSTTSKI SPSEDTQQEN GSMFSLITWN IDGLDLNNLS ERARGVCSYL ALYSPDVIFL QEVIPPYYSY LKKRSSNYEI ITGHEEGYFT AIMLKKSRVK LKSQEIIPFP. It is sometimes possible for the material contained within the vial of "Doublecortin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.