Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200026_WB11.jpg WB (Western Blot) (WB Suggested Anti-EDAR Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

Rabbit EDAR Polyclonal Antibody | anti-EDAR antibody

EDAR antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
EDAR; DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EDAR, Antibody; EDAR antibody - middle region; anti-EDAR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV
Sequence Length
448
Applicable Applications for anti-EDAR antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EDAR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EDAR Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

product-image-AAA200026_WB11.jpg WB (Western Blot) (WB Suggested Anti-EDAR Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200026_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA200026_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EDAR antibody
This is a rabbit polyclonal antibody against EDAR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member EDAR
NCBI Official Synonym Full Names
ectodysplasin A receptor
NCBI Official Symbol
EDAR
NCBI Official Synonym Symbols
DL; ED3; ED5; ED1R; EDA3; HRM1; EDA1R; ECTD10A; ECTD10B; EDA-A1R
NCBI Protein Information
tumor necrosis factor receptor superfamily member EDAR
UniProt Protein Name
Tumor necrosis factor receptor superfamily member EDAR
UniProt Gene Name
EDAR
UniProt Synonym Gene Names
DL
UniProt Entry Name
EDAR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EDAR edar (Catalog #AAA200026) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDAR antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EDAR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EDAR edar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAPDKQGSPE LCLLSLVHLA REKSATSNKS AGIQSRRKKI LDVYANVCGV. It is sometimes possible for the material contained within the vial of "EDAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.