WB (Western Blot)
(Host: RabbitTarget Name: EPHA2Sample Tissue: Human HCT15 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human EPHA2 Polyclonal Antibody | anti-EPHA2 antibody
EPHA2 Antibody - N-terminal region
Gene Names
EPHA2; ECK; CTPA; ARCC2; CTPP1; CTRCT6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EPHA2, Antibody; EPHA2 Antibody - N-terminal region; anti-EPHA2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGAS
Sequence Length
976
Applicable Applications for anti-EPHA2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EPHA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: EPHA2Sample Tissue: Human HCT15 Whole Cell lysatesAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: EPHA2Sample Tissue: Human HCT15 Whole Cell lysatesAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-EPHA2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-EPHA2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-EPHA2 antibody
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Mutations in this gene are the cause of certain genetically-related cataract disorders.
Product Categories/Family for anti-EPHA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107 kDa
NCBI Official Full Name
ephrin type-A receptor 2 isoform 1
NCBI Official Synonym Full Names
EPH receptor A2
NCBI Official Symbol
EPHA2
NCBI Official Synonym Symbols
ECK; CTPA; ARCC2; CTPP1; CTRCT6
NCBI Protein Information
ephrin type-A receptor 2
UniProt Protein Name
Ephrin type-A receptor 2
UniProt Gene Name
EPHA2
UniProt Synonym Gene Names
ECK
UniProt Entry Name
EPHA2_HUMAN
Similar Products
Product Notes
The EPHA2 epha2 (Catalog #AAA201562) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPHA2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPHA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EPHA2 epha2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IYMYSVCNVM SGDQDNWLRT NWVYRGEAER IFIELKFTVR DCNSFPGGAS. It is sometimes possible for the material contained within the vial of "EPHA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.