WB (Western Blot)
(WB Suggested Anti-ERLIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateERLIN1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Rabbit ERLIN1 Polyclonal Antibody | anti-ERLIN1 antibody
ERLIN1 antibody - N-terminal region
Gene Names
ERLIN1; KE04; KEO4; SPFH1; SPG62; Erlin-1; C10orf69
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERLIN1, Antibody; ERLIN1 antibody - N-terminal region; anti-ERLIN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH
Sequence Length
348
Applicable Applications for anti-ERLIN1 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERLIN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ERLIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateERLIN1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(WB Suggested Anti-ERLIN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateERLIN1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(Host: RabbitTarget Name: ERLIN1Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlERLIN1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: ERLIN1Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlERLIN1 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: ERLIN1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlERLIN1 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(Host: RabbitTarget Name: ERLIN1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlERLIN1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ERLIN1 antibody
This is a rabbit polyclonal antibody against ERLIN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.
Target Description: Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER.
Product Categories/Family for anti-ERLIN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
erlin-1 isoform a
NCBI Official Synonym Full Names
ER lipid raft associated 1
NCBI Official Symbol
ERLIN1
NCBI Official Synonym Symbols
KE04; KEO4; SPFH1; SPG62; Erlin-1; C10orf69
NCBI Protein Information
erlin-1
UniProt Protein Name
Erlin-1
UniProt Gene Name
ERLIN1
UniProt Synonym Gene Names
C10orf69; KE04; KEO4; SPFH1; SPFH domain-containing protein 1
UniProt Entry Name
ERLN1_HUMAN
Similar Products
Product Notes
The ERLIN1 erlin1 (Catalog #AAA199739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERLIN1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ERLIN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ERLIN1 erlin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNVPCGTSGG VMIYIDRIEV VNMLAPYAVF DIVRNYTADY DKTLIFNKIH. It is sometimes possible for the material contained within the vial of "ERLIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.