WB (Western Blot)
(Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)
Rabbit Estrogen-Related Receptor Gamma Polyclonal Antibody | anti-ESRRG antibody
Estrogen-Related Receptor Gamma antibody
Gene Names
ESRRG; ERR3; NR3B3; ERRgamma
Applications
Western Blot
Purity
Affinity purified
Synonyms
Estrogen-Related Receptor Gamma, Antibody; Estrogen-Related Receptor Gamma antibody; Polyclonal Estrogen-Related Receptor Gamma; Anti-Estrogen-Related Receptor Gamma; DKFZp781L1617; NR3B3; ERR3; ESRRG; KIAA0832; FLJ16023; anti-ESRRG antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Estrogen-Related Receptor Gamma antibody was raised against the N terminal of ESRRG
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESRRG antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
435
Applicable Applications for anti-ESRRG antibody
WB (Western Blot)
Biological Significance
ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
Cross-Reactivity
Human
Immunogen
Estrogen-Related Receptor Gamma antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
WB (Western Blot)
(Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Recommended ESRRG Antibody Titration: 0.2-1 ug/ml)
WB (Western Blot)
(Recommended ESRRG Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-ESRRG antibody
Rabbit polyclonal Estrogen-Related Receptor Gamma antibody raised against the N terminal of ESRRG
Product Categories/Family for anti-ESRRG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
51 kDa (MW of target protein)
NCBI Official Full Name
estrogen-related receptor gamma
NCBI Official Synonym Full Names
estrogen-related receptor gamma
NCBI Official Symbol
ESRRG
NCBI Official Synonym Symbols
ERR3; NR3B3; ERRgamma
NCBI Protein Information
estrogen-related receptor gamma
UniProt Protein Name
Estrogen-related receptor gamma
UniProt Gene Name
ESRRG
UniProt Synonym Gene Names
ERR3; ERRG2; KIAA0832; NR3B3
UniProt Entry Name
ERR3_HUMAN
Similar Products
Product Notes
The ESRRG esrrg (Catalog #AAA224328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Estrogen-Related Receptor Gamma can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ESRRG esrrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Estrogen-Related Receptor Gamma, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.