Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA225820_IHC11.jpg IHC (Immunohistochemisry) (EXOSC6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)

Rabbit anti-Human, Dog EXOSC6 Polyclonal Antibody | anti-EXOSC6 antibody

EXOSC6 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
EXOSC6, Antibody; EXOSC6 Antibody; Rabbit Polyclonal EXOSC6 Antibody raised against the N terminal of EXOSC6; Polyclonal EXOSC6 antibody; Anti-EXOSC6 antibody; EXOSC 6 antibody; EXOSC 6; EXOSC-6 antibody; EXOSC6; Exosome Component 6 antibody; EXOSC-6; anti-EXOSC6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Dog
Clonality
Polyclonal
Specificity
EXOSC6 antibody was raised against the N terminal of EXOSC6
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-EXOSC6 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK
Cross-Reactivity
Human,Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohistochemisry)

(EXOSC6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)

product-image-AAA225820_IHC11.jpg IHC (Immunohistochemisry) (EXOSC6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X)

WB (Western Blot)

(EXOSC6 antibody used at 5 ug/ml to detect target protein.)

product-image-AAA225820_WB13.jpg WB (Western Blot) (EXOSC6 antibody used at 5 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(EXOSC6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X.)

product-image-AAA225820_IHC15.jpg IHC (Immunohistochemistry) (EXOSC6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X.)
Related Product Information for anti-EXOSC6 antibody
EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.
Product Categories/Family for anti-EXOSC6 antibody

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EXOSC6 (Catalog #AAA225820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXOSC6 Antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC6 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EXOSC6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOSC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.