Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199031_WB10.jpg WB (Western Blot) (WB Suggested Anti-F13B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit F13B Polyclonal Antibody | anti-F13B antibody

F13B antibody - middle region

Gene Names
F13B; FXIIIB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F13B, Antibody; F13B antibody - middle region; anti-F13B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP
Sequence Length
661
Applicable Applications for anti-F13B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human F13B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-F13B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

product-image-AAA199031_WB10.jpg WB (Western Blot) (WB Suggested Anti-F13B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: F13BSample Tissue: Human DLD1Antibody Dilution: 1.0ug/ml)

product-image-AAA199031_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: F13BSample Tissue: Human DLD1Antibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-F13B antibodyFormalin Fixed Paraffin Embedded Tissue: Human VesselPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA199031_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-F13B antibodyFormalin Fixed Paraffin Embedded Tissue: Human VesselPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-F13B antibodyFormalin Fixed Paraffin Embedded Tissue: Human Fetal LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA199031_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-F13B antibodyFormalin Fixed Paraffin Embedded Tissue: Human Fetal LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-F13B antibody
This is a rabbit polyclonal antibody against F13B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-F13B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
coagulation factor XIII B chain
NCBI Official Synonym Full Names
coagulation factor XIII B chain
NCBI Official Symbol
F13B
NCBI Official Synonym Symbols
FXIIIB
NCBI Protein Information
coagulation factor XIII B chain
UniProt Protein Name
Coagulation factor XIII B chain
UniProt Gene Name
F13B
UniProt Entry Name
F13B_HUMAN

Similar Products

Product Notes

The F13B f13b (Catalog #AAA199031) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F13B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's F13B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the F13B f13b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRLIENGYFH PVKQTYEEGD VVQFFCHENY YLSGSDLIQC YNFGWYPESP. It is sometimes possible for the material contained within the vial of "F13B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.