Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46239_WB15.jpg WB (Western Blot) (Anti- FMRP Picoband antibody, Western blottingAll lanes: Anti FMRP at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 71KDObserved bind size: 71KD)

FMRP Polyclonal Antibody | anti-FMRP antibody

Synaptic functional regulator FMR1

Average rating 0.0
No ratings yet
Gene Names
FMR1; POF; FMRP; POF1; FRAXA
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FMRP, Antibody; Synaptic functional regulator FMR1; anti-FMRP antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
537
Applicable Applications for anti-FMRP antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
content
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- FMRP Picoband antibody, Western blottingAll lanes: Anti FMRP at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 71KDObserved bind size: 71KD)

product-image-AAA46239_WB15.jpg WB (Western Blot) (Anti- FMRP Picoband antibody, Western blottingAll lanes: Anti FMRP at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 71KDObserved bind size: 71KD)
Related Product Information for anti-FMRP antibody
Background: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
References
1. Verkerk AJ, Pieretti M, Sutcliffe JS, Fu YH, Kuhl DP, Pizzuti A, Reiner O, Richards S, Victoria MF, Zhang FP (May 1991). "Identification of a gene (FMR-1) containing a CGG repeat coincident with a breakpoint cluster region exhibiting length variation in fragile X syndrome". Cell 65(5): 905-14. 2. Verheij C, Bakker CE, de Graaff E, Keulemans J, Willemsen R, Verkerk AJ, Galjaard H, Reuser AJ, Hoogeveen AT, Oostra BA (June 1993). "Characterization and localization of the FMR-1 gene product associated with fragile X syndrome". Nature 363 (6431): 722-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fragile X mental retardation protein 1 isoform ISO6
NCBI Official Synonym Full Names
fragile X mental retardation 1
NCBI Official Symbol
FMR1
NCBI Official Synonym Symbols
POF; FMRP; POF1; FRAXA
NCBI Protein Information
fragile X mental retardation protein 1
UniProt Protein Name
Fragile X mental retardation protein 1
UniProt Gene Name
FMR1
UniProt Synonym Gene Names
FMRP; Protein FMR-1
UniProt Entry Name
FMR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FMRP fmr1 (Catalog #AAA46239) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Synaptic functional regulator FMR1 reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FMRP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FMRP fmr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.