FMRP Polyclonal Antibody | anti-FMRP antibody

Synaptic functional regulator FMR1

Cat. Num. AAA46239

• Gene Names: FMR1; POF; FMRP; POF1; FRAXA
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: FMRP, Antibody; Synaptic functional regulator FMR1; anti-FMRP antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized
• Sequence Length: 537

• Applicable Applications for anti-FMRP antibody: WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• content: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- FMRP Picoband antibody, Western blottingAll lanes: Anti FMRP at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 71KDObserved bind size: 71KD)

Related Product Information for anti-FMRP antibody

Background: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

References

1. Verkerk AJ, Pieretti M, Sutcliffe JS, Fu YH, Kuhl DP, Pizzuti A, Reiner O, Richards S, Victoria MF, Zhang FP (May 1991). "Identification of a gene (FMR-1) containing a CGG repeat coincident with a breakpoint cluster region exhibiting length variation in fragile X syndrome". Cell 65(5): 905-14. 2. Verheij C, Bakker CE, de Graaff E, Keulemans J, Willemsen R, Verkerk AJ, Galjaard H, Reuser AJ, Hoogeveen AT, Oostra BA (June 1993). "Characterization and localization of the FMR-1 gene product associated with fragile X syndrome". Nature 363 (6431): 722-4.

NCBI and Uniprot Product Information

• NCBI GI #: 297374777
• NCBI GeneID: 2332
• NCBI Accession #: NP_001172004.1
• NCBI GenBank Nucleotide #: NM_001185075.1
• UniProt Accession #: Q06787; Q16578; Q5PQZ6; Q99054; A6NNH4; D3DWT0; D3DWT1; D3DWT2; G8JL90
• NCBI Official Full Name: fragile X mental retardation protein 1 isoform ISO6
• NCBI Official Synonym Full Names: fragile X mental retardation 1
• NCBI Official Symbol: FMR1
• NCBI Official Synonym Symbols: POF; FMRP; POF1; FRAXA
• NCBI Protein Information: fragile X mental retardation protein 1
• UniProt Protein Name: Fragile X mental retardation protein 1
• UniProt Gene Name: FMR1
• UniProt Synonym Gene Names: FMRP; Protein FMR-1
• UniProt Entry Name: FMR1_HUMAN