WB (Western Blot)
(WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
Rabbit FOS Polyclonal Antibody | anti-FOS antibody
FOS antibody - middle region
Gene Names
FOS; p55; AP-1; C-FOS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOS, Antibody; FOS antibody - middle region; anti-FOS antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
Sequence Length
380
Applicable Applications for anti-FOS antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FOS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
WB (Western Blot)
(WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
IHC (Immunohistochemistry)
(Rabbit Anti-FOS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-FOS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FOS antibody
This is a rabbit polyclonal antibody against FOS. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-FOS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
proto-oncogene c-Fos
NCBI Official Synonym Full Names
Fos proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
FOS
NCBI Official Synonym Symbols
p55; AP-1; C-FOS
NCBI Protein Information
proto-oncogene c-Fos
UniProt Protein Name
Proto-oncogene c-Fos
UniProt Gene Name
FOS
UniProt Synonym Gene Names
G0S7
UniProt Entry Name
FOS_HUMAN
Similar Products
Product Notes
The FOS fos (Catalog #AAA197386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FOS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FOS fos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSVEPVKSIS SMELKTEPFD DFLFPASSRP SGSETARSVP DMDLSGSFYA. It is sometimes possible for the material contained within the vial of "FOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.