Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201687_WB8.jpg WB (Western Blot) (WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit FOS Polyclonal Antibody | anti-FOS antibody

FOS antibody - N-terminal region

Gene Names
FOS; p55; AP-1; C-FOS
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FOS, Antibody; FOS antibody - N-terminal region; anti-FOS antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT
Sequence Length
380
Applicable Applications for anti-FOS antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

product-image-AAA201687_WB8.jpg WB (Western Blot) (WB Suggested Anti-FOS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: FOSSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201687_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: FOSSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOSSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201687_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FOSSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FOSSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201687_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FOSSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-FOS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Nucleus in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201687_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOS AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Nucleus in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FOS antibody
This is a rabbit polyclonal antibody against FOS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The Fos family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. The family members are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
proto-oncogene c-Fos
NCBI Official Synonym Full Names
Fos proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
FOS
NCBI Official Synonym Symbols
p55; AP-1; C-FOS
NCBI Protein Information
proto-oncogene c-Fos
UniProt Protein Name
Proto-oncogene c-Fos
UniProt Gene Name
FOS
UniProt Synonym Gene Names
G0S7
UniProt Entry Name
FOS_HUMAN

Similar Products

Product Notes

The FOS fos (Catalog #AAA201687) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOS antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FOS can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FOS fos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFSGFNADYE ASSSRCSSAS PAGDSLSYYH SPADSFSSMG SPVNAQDFCT. It is sometimes possible for the material contained within the vial of "FOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.