Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198856_WB10.jpg WB (Western Blot) (WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Fetal Liver)

Rabbit FZD4 Polyclonal Antibody | anti-FZD4 antibody

FZD4 antibody - middle region

Gene Names
FZD4; Fz4; EVR1; FEVR; Fz-4; FzE4; GPCR; hFz4; CD344; FZD4S
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FZD4, Antibody; FZD4 antibody - middle region; anti-FZD4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Sequence Length
537
Applicable Applications for anti-FZD4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FZD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Fetal Liver)

product-image-AAA198856_WB10.jpg WB (Western Blot) (WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Fetal Liver)

WB (Western Blot)

(Host: RabbitTarget Name: FZD4Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA198856_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FZD4Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FZD4Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA198856_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FZD4Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Skin)

product-image-AAA198856_IHC15.jpg IHC (Immunohistochemistry) (Skin)
Related Product Information for anti-FZD4 antibody
This is a rabbit polyclonal antibody against FZD4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
frizzled-4
NCBI Official Synonym Full Names
frizzled class receptor 4
NCBI Official Symbol
FZD4
NCBI Official Synonym Symbols
Fz4; EVR1; FEVR; Fz-4; FzE4; GPCR; hFz4; CD344; FZD4S
NCBI Protein Information
frizzled-4
UniProt Protein Name
Frizzled-4
UniProt Gene Name
FZD4
UniProt Synonym Gene Names
Fz-4; hFz4
UniProt Entry Name
FZD4_HUMAN

Similar Products

Product Notes

The FZD4 fzd4 (Catalog #AAA198856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FZD4 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FZD4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FZD4 fzd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GITSGMWIWS AKTLHTWQKC SNRLVNSGKV KREKRGNGWV KPGKGSETVV. It is sometimes possible for the material contained within the vial of "FZD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.