Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281483_IF11.jpg IF (Immunofluorescence) (Immunofluorescence-GAP43 Polyclonal Antibody)

Rabbit anti-Mouse, Rat GAP43 Polyclonal Antibody | anti-GAP43 antibody

GAP43 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
GAP43; B-50; PP46
Reactivity
Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
GAP43, Antibody; GAP43 Polyclonal Antibody; GAP43; B-50; PP46; neuromodulin; anti-GAP43 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.95 mg/ml (varies by lot)
Sequence Length
274
Applicable Applications for anti-GAP43 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human GAP43 (NP_002036.1).
Immunogen Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence-GAP43 Polyclonal Antibody)

product-image-AAA281483_IF11.jpg IF (Immunofluorescence) (Immunofluorescence-GAP43 Polyclonal Antibody)

IHC (Immunohiostchemistry)

(Immunohistochemistry-GAP43 Polyclonal Antibody)

product-image-AAA281483_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry-GAP43 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-GAP43 Polyclonal Antibody)

product-image-AAA281483_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry-GAP43 Polyclonal Antibody)
Related Product Information for anti-GAP43 antibody
The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa; 28kDa
NCBI Official Full Name
neuromodulin isoform 1
NCBI Official Synonym Full Names
growth associated protein 43
NCBI Official Symbol
GAP43
NCBI Official Synonym Symbols
B-50; PP46
NCBI Protein Information
neuromodulin
UniProt Protein Name
Neuromodulin
UniProt Gene Name
GAP43
UniProt Entry Name
NEUM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GAP43 gap43 (Catalog #AAA281483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAP43 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAP43 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GAP43 gap43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAP43, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.