Rabbit GNA14 Polyclonal Antibody | anti-GNA14 antibody
GNA14 antibody - N-terminal region
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNA14, Antibody; GNA14 antibody - N-terminal region; anti-GNA14 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK
Sequence Length
355
Applicable Applications for anti-GNA14 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Protein Size (# AA)
355 amino acids
Protein Interactions
DNAL4; JMJD6; OPRL1; CCR1; SSTR2; CXCR1; CXCR2; CHRM2; ADRB2;
Blocking Peptide
GNA14 peptide ( ) is used for blocking the activity of GNA14 antibody
Preparation and Storage
For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-GNA14 antibody
Target Description: This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.
Product Categories/Family for anti-GNA14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
guanine nucleotide-binding protein subunit alpha-14
NCBI Official Synonym Full Names
G protein subunit alpha 14
NCBI Official Symbol
GNA14
NCBI Protein Information
guanine nucleotide-binding protein subunit alpha-14
UniProt Protein Name
Guanine nucleotide-binding protein subunit alpha-14
UniProt Gene Name
GNA14
UniProt Synonym Gene Names
G alpha-14
UniProt Entry Name
GNA14_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GNA14 gna14 (Catalog #AAA201332) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNA14 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNA14 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNA14 gna14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLRRDKKDAR RELKLLLLGT GESGKSTFIK QMRIIHGSGY SDEDRKGFTK. It is sometimes possible for the material contained within the vial of "GNA14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
