Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23504_WB11.jpg WB (Western Blot) (WB Suggested Anti-GNAS Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

Rabbit GNAS Polyclonal Antibody | anti-GNAS antibody

GNAS antibody - N-terminal region

Gene Names
GNAS; AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GNAS, Antibody; GNAS antibody - N-terminal region; anti-GNAS antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Sequence Length
380
Applicable Applications for anti-GNAS antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GNAS Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

product-image-AAA23504_WB11.jpg WB (Western Blot) (WB Suggested Anti-GNAS Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat)

WB (Western Blot)

(WB Suggested Anti-GNAS Antibody Titration: 1ug/mLPositive Control: HepG2 lysateThere is BioGPS gene expression data showing that GNAS is expressed in HepG2)

product-image-AAA23504_WB10.jpg WB (Western Blot) (WB Suggested Anti-GNAS Antibody Titration: 1ug/mLPositive Control: HepG2 lysateThere is BioGPS gene expression data showing that GNAS is expressed in HepG2)

WB (Western Blot)

(WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human MCF7)

product-image-AAA23504_WB9.jpg WB (Western Blot) (WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human MCF7)

WB (Western Blot)

(WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human Jurkat)

product-image-AAA23504_WB8.jpg WB (Western Blot) (WB Suggested Anti-GNAS antibody Titration: 1 ug/mLSample Type: Human Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

product-image-AAA23504_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

WB (Western Blot)

(Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23504_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GNASSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23504_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GNASSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GNASSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23504_WB4.jpg WB (Western Blot) (Host: MouseTarget Name: GNASSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GNAS AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23504_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-GNAS AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA23504_IHC2.jpg IHC (Immunohistochemistry) (Human Lung)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA23504_IHC.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-GNAS antibody
This is a rabbit polyclonal antibody against GNAS. It was validated on Western Blot and immunohistochemistry

Target Description: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance. There are RefSeqs representing four transcript variants of this gene. Other transcript variants including four additional exons have been described; however, their full length sequences have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
protein GNAS isoform GNASS
NCBI Official Synonym Full Names
GNAS complex locus
NCBI Official Symbol
GNAS
NCBI Official Synonym Symbols
AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
NCBI Protein Information
protein ALEX; protein GNAS; protein SCG6 (secretogranin VI)
UniProt Protein Name
GNAS complex locus
UniProt Gene Name
GNAS
UniProt Entry Name
Q5FWY2_HUMAN

Similar Products

Product Notes

The GNAS gnas (Catalog #AAA23504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAS antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNAS can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GNAS gnas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGKSTIVKQM RILHVNGFNG DSEKATKVQD IKNNLKEAIE TIVAAMSNLV. It is sometimes possible for the material contained within the vial of "GNAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.