WB (Western Blot)
(WB Suggested Anti-GNL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Rabbit GNL3 Polyclonal Antibody | anti-GNL3 antibody
GNL3 antibody - N-terminal region
Gene Names
GNL3; NS; E2IG3; NNP47; C77032
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNL3, Antibody; GNL3 antibody - N-terminal region; anti-GNL3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR
Sequence Length
537
Applicable Applications for anti-GNL3 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GNL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
WB (Western Blot)
(WB Suggested Anti-GNL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
WB (Western Blot)
(Host: MouseTarget Name: GNL3Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: GNL3Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-GNL3 antibody
This is a rabbit polyclonal antibody against GNL3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
Target Description: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
Product Categories/Family for anti-GNL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
guanine nucleotide-binding protein-like 3 isoform 2
NCBI Official Synonym Full Names
G protein nucleolar 3
NCBI Official Symbol
GNL3
NCBI Official Synonym Symbols
NS; E2IG3; NNP47; C77032
NCBI Protein Information
guanine nucleotide-binding protein-like 3
UniProt Protein Name
Guanine nucleotide-binding protein-like 3
UniProt Gene Name
GNL3
UniProt Synonym Gene Names
E2IG3; NS
UniProt Entry Name
GNL3_HUMAN
Similar Products
Product Notes
The GNL3 gnl3 (Catalog #AAA200863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNL3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GNL3 gnl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTCHKRYKIQ KKVREHHRKL RKEAKKRGHK KPRKDPGVPN SAPFKEALLR. It is sometimes possible for the material contained within the vial of "GNL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.