Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198197_WB11.jpg WB (Western Blot) (WB Suggested Anti-GPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit GPC3 Polyclonal Antibody | anti-GPC3 antibody

GPC3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GPC3; SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GPC3, Antibody; GPC3 antibody - middle region; anti-GPC3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Sequence Length
580
Applicable Applications for anti-GPC3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA198197_WB11.jpg WB (Western Blot) (WB Suggested Anti-GPC3 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: GPC3Sample Tissue: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA198197_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GPC3Sample Tissue: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GPC3 antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198197_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-GPC3 antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-GPC3 antibody
This is a rabbit polyclonal antibody against GPC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
Product Categories/Family for anti-GPC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
glypican-3 isoform 2
NCBI Official Synonym Full Names
glypican 3
NCBI Official Symbol
GPC3
NCBI Official Synonym Symbols
SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2
NCBI Protein Information
glypican-3
UniProt Protein Name
Glypican-3
UniProt Gene Name
GPC3
UniProt Synonym Gene Names
OCI5
UniProt Entry Name
GPC3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPC3 gpc3 (Catalog #AAA198197) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPC3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPC3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GPC3 gpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSTIHDSIQY VQKNAGKLTT TIGKLCAHSQ QRQYRSAYYP EDLFIDKKVL. It is sometimes possible for the material contained within the vial of "GPC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.