Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200201_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADRBK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysateADRBK1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)

Rabbit GRK2 Polyclonal Antibody | anti-GRK2 antibody

GRK2 Antibody - C-terminal region

Gene Names
GRK2; BARK1; ADRBK1; BETA-ARK1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRK2, Antibody; GRK2 Antibody - C-terminal region; anti-GRK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPL
Sequence Length
689
Applicable Applications for anti-GRK2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADRBK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADRBK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysateADRBK1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)

product-image-AAA200201_WB13.jpg WB (Western Blot) (WB Suggested Anti-ADRBK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysateADRBK1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells)

WB (Western Blot)

(Host: MouseTarget Name: GRK2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA200201_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: GRK2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-GRK2 antibody
This is a rabbit polyclonal antibody against ADRBK1. It was validated on Western Blot

Target Description: This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease.
Product Categories/Family for anti-GRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
156
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
beta-adrenergic receptor kinase 1
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 2
NCBI Official Symbol
GRK2
NCBI Official Synonym Symbols
BARK1; ADRBK1; BETA-ARK1
NCBI Protein Information
beta-adrenergic receptor kinase 1
UniProt Protein Name
Beta-adrenergic receptor kinase 1
UniProt Gene Name
ADRBK1
UniProt Synonym Gene Names
BARK; BARK1; GRK2; Beta-ARK-1
UniProt Entry Name
ARBK1_HUMAN

Similar Products

Product Notes

The GRK2 adrbk1 (Catalog #AAA200201) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRK2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GRK2 adrbk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILQCDSDPEL VQWKKELRDA YREAQQLVQR VPKMKNKPRS PVVELSKVPL. It is sometimes possible for the material contained within the vial of "GRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.