Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23559_WB7.jpg WB (Western Blot) (WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateGSK3B is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit GSK3B Polyclonal Antibody | anti-GSK3B antibody

GSK3B antibody - C-terminal region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GSK3B, Antibody; GSK3B antibody - C-terminal region; anti-GSK3B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF
Sequence Length
433
Applicable Applications for anti-GSK3B antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateGSK3B is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23559_WB7.jpg WB (Western Blot) (WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateGSK3B is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: GSK3BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23559_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: GSK3BSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GSK3BSample Type: HelaAntibody Dilution: 1.0ug/mlGSK3B is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23559_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GSK3BSample Type: HelaAntibody Dilution: 1.0ug/mlGSK3B is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: GSK3BSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA23559_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: GSK3BSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GSK3BSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA23559_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: GSK3BSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GSK3B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm, Nucleus, Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23559_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-GSK3B AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm, Nucleus, Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Sample Type: Human brainBrain, cortex)

product-image-AAA23559_IHC.jpg IHC (Immunohistochemistry) (Sample Type: Human brainBrain, cortex)
Related Product Information for anti-GSK3B antibody
This is a rabbit polyclonal antibody against GSK3B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A) and beta, show a high degree of amino acid homology. GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
glycogen synthase kinase-3 beta isoform 1
NCBI Official Synonym Full Names
glycogen synthase kinase 3 beta
NCBI Official Symbol
GSK3B
NCBI Protein Information
glycogen synthase kinase-3 beta
UniProt Protein Name
Glycogen synthase kinase-3 beta
UniProt Gene Name
GSK3B
UniProt Synonym Gene Names
GSK-3 beta
UniProt Entry Name
GSK3B_HUMAN

Similar Products

Product Notes

The GSK3B gsk3b (Catalog #AAA23559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSK3B antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GSK3B can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GSK3B gsk3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIALCSRLLE YTPTARLTPL EACAHSFFDE LRDPNVKLPN GRDTPALFNF. It is sometimes possible for the material contained within the vial of "GSK3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.