Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200372_WB11.jpg WB (Western Blot) (WB Suggested Anti-HAGH Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit HAGH Polyclonal Antibody | anti-HAGH antibody

HAGH antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
HAGH; GLO2; GLX2; GLXII; HAGH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAGH, Antibody; HAGH antibody - C-terminal region; anti-HAGH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD
Sequence Length
260
Applicable Applications for anti-HAGH antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HAGH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HAGH Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA200372_WB11.jpg WB (Western Blot) (WB Suggested Anti-HAGH Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: HAGHSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200372_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: HAGHSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HAGHSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200372_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: HAGHSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HAGH antibody
This is a rabbit polyclonal antibody against HAGH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HAGH belongs to the metallo-beta-lactamase superfamily, glyoxalase II family. It is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.
Product Categories/Family for anti-HAGH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
hydroxyacylglutathione hydrolase, mitochondrial isoform 2
NCBI Official Synonym Full Names
hydroxyacylglutathione hydrolase
NCBI Official Symbol
HAGH
NCBI Official Synonym Symbols
GLO2; GLX2; GLXII; HAGH1
NCBI Protein Information
hydroxyacylglutathione hydrolase, mitochondrial
UniProt Protein Name
Hydroxyacylglutathione hydrolase, mitochondrial
UniProt Gene Name
HAGH
UniProt Synonym Gene Names
GLO2; HAGH1; Glx II
UniProt Entry Name
GLO2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HAGH hagh (Catalog #AAA200372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAGH antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HAGH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HAGH hagh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STLAEEFTYN PFMRVREKTV QQHAGETDPV TTMRAVRREK DQFKMPRD. It is sometimes possible for the material contained within the vial of "HAGH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.