Rabbit HCAR2 Polyclonal Antibody | anti-HCAR2 antibody
HCAR2 antibody - C-terminal region
Gene Names
HCAR2; HCA2; HM74a; HM74b; PUMAG; NIACR1; Puma-g; GPR109A
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HCAR2, Antibody; HCAR2 antibody - C-terminal region; anti-HCAR2 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE
Sequence Length
363
Applicable Applications for anti-HCAR2 antibody
WB (Western Blot)
Homology
Cow: 91%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-HCAR2 antibody
This is a rabbit polyclonal antibody against HCAR2. It was validated on Western Blot
Target Description: HCAR2 acts as a high affinity receptor for both nicotinic acid (also known as niacin) and (D)-beta-hydroxybutyrate and mediates increased adiponectin secretion and decreased lipolysis through G(i)-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet. Mediates nicotinic acid-induced apoptosis in mature neutrophils. Receptor activation by nicotinic acid results in reduced cAMP levels which may affect activity of cAMP-dependent protein kinase A and phosphorylation of target proteins, leading to neutrophil apoptosis. The rank order of potency for the displacement of nicotinic acid binding is 5-methyl pyrazole-3-carboxylic acid = pyridine-3-acetic acid > acifran > 5-methyl nicotinic acid = acipimox >> nicotinuric acid = nicotinamide.
Target Description: HCAR2 acts as a high affinity receptor for both nicotinic acid (also known as niacin) and (D)-beta-hydroxybutyrate and mediates increased adiponectin secretion and decreased lipolysis through G(i)-protein-mediated inhibition of adenylyl cyclase. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet. Mediates nicotinic acid-induced apoptosis in mature neutrophils. Receptor activation by nicotinic acid results in reduced cAMP levels which may affect activity of cAMP-dependent protein kinase A and phosphorylation of target proteins, leading to neutrophil apoptosis. The rank order of potency for the displacement of nicotinic acid binding is 5-methyl pyrazole-3-carboxylic acid = pyridine-3-acetic acid > acifran > 5-methyl nicotinic acid = acipimox >> nicotinuric acid = nicotinamide.
Product Categories/Family for anti-HCAR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
hydroxycarboxylic acid receptor 2
NCBI Official Synonym Full Names
hydroxycarboxylic acid receptor 2
NCBI Official Symbol
HCAR2
NCBI Official Synonym Symbols
HCA2; HM74a; HM74b; PUMAG; NIACR1; Puma-g; GPR109A
NCBI Protein Information
hydroxycarboxylic acid receptor 2
UniProt Protein Name
Hydroxycarboxylic acid receptor 2
UniProt Gene Name
HCAR2
UniProt Synonym Gene Names
GPR109A; HCA2; HM74A; NIACR1
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HCAR2 hcar2 (Catalog #AAA201245) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCAR2 antibody - C-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HCAR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HCAR2 hcar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YYFSSPSFPN FFSTLINRCL QRKMTGEPDN NRSTSVELTG DPNKTRGAPE. It is sometimes possible for the material contained within the vial of "HCAR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
