Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit HCLS1 Polyclonal Antibody | anti-HCLS1 antibody

HCLS1 antibody - N-terminal region

Gene Names
HCLS1; HS1; p75; CTTNL; lckBP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HCLS1; Polyclonal Antibody; HCLS1 antibody - N-terminal region; anti-HCLS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Sequence Length
486
Applicable Applications for anti-HCLS1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: MouseTarget Name: HCLS1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: MouseTarget Name: HCLS1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human StomachCellular Data: Epithelial cells of Fundic GlandAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry) (Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human StomachCellular Data: Epithelial cells of Fundic GlandAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry) (Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry) (Rabbit Anti-HCLS1 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-HCLS1 antibody
This is a rabbit polyclonal antibody against HCLS1. It was validated on Western Blot and immunohistochemistry

Target Description: HCLS1 is a substrate for caspase cleavage during apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
hematopoietic lineage cell-specific protein isoform 1
NCBI Official Synonym Full Names
hematopoietic cell-specific Lyn substrate 1
NCBI Official Symbol
HCLS1
NCBI Official Synonym Symbols
HS1; p75; CTTNL; lckBP1
NCBI Protein Information
hematopoietic lineage cell-specific protein
UniProt Protein Name
Hematopoietic lineage cell-specific protein
UniProt Gene Name
HCLS1
UniProt Synonym Gene Names
HS1
UniProt Entry Name
HCLS1_HUMAN

Similar Products

Product Notes

The HCLS1 hcls1 (Catalog #AAA23398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCLS1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HCLS1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HCLS1 hcls1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VNDISEKEQR WGAKTIEGSG RTEHINIHQL RNKVSEEHDV LRKKEMESGP. It is sometimes possible for the material contained within the vial of "HCLS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.