WB (Western Blot)
(WB Suggested Anti-HLA-DPB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Rabbit HLA-DPB1 Polyclonal Antibody | anti-HLA-DPB1 antibody
HLA-DPB1 antibody - middle region
Gene Names
HLA-DPB1; DPB1; HLA-DP; HLA-DPB; HLA-DP1B
Reactivity
Dog, Human, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HLA-DPB1, Antibody; HLA-DPB1 antibody - middle region; anti-HLA-DPB1 antibody
Host
Rabbit
Reactivity
Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVT
Sequence Length
258
Applicable Applications for anti-HLA-DPB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 86%; Human: 100%; Rabbit: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-HLA-DPB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
WB (Western Blot)
(WB Suggested Anti-HLA-DPB1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
IHC (Immunohistochemistry)
(Rabbit Anti-HLA-DPB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-HLA-DPB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HLA-DPB1 antibody
This is a rabbit polyclonal antibody against HLA-DPB1. It was validated on Western Blot
Target Description: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.
Target Description: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.
Product Categories/Family for anti-HLA-DPB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DP beta 1 chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DP beta 1
NCBI Official Symbol
HLA-DPB1
NCBI Official Synonym Symbols
DPB1; HLA-DP; HLA-DPB; HLA-DP1B
NCBI Protein Information
HLA class II histocompatibility antigen, DP beta 1 chain
UniProt Protein Name
HLA class II histocompatibility antigen, DP beta 1 chain
UniProt Gene Name
HLA-DPB1
UniProt Synonym Gene Names
HLA-DP1B
UniProt Entry Name
DPB1_HUMAN
Similar Products
Product Notes
The HLA-DPB1 hla-dpb1 (Catalog #AAA201174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-DPB1 antibody - middle region reacts with Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DPB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HLA-DPB1 hla-dpb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRAVPDRMCR HNYELGGPMT LQRRVQPRVN VSPSKKGPLQ HHNLLVCHVT. It is sometimes possible for the material contained within the vial of "HLA-DPB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.