Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281230_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using HMGCR antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse HMGCR Polyclonal Antibody | anti-HMGCR antibody

HMGCR Polyclonal Antibody

Gene Names
HMGCR; LDLCQ3
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
HMGCR, Antibody; HMGCR Polyclonal Antibody; LDLCQ3; anti-HMGCR antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGAC
Sequence Length
888
Applicable Applications for anti-HMGCR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human HMGCR
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spleen using HMGCR antibody at dilution of 1:100 (40x lens).)

product-image-AAA281230_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using HMGCR antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using HMGCR antibody at dilution of 1:100 (40x lens).)

product-image-AAA281230_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using HMGCR antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using HMGCR antibody at dilution of 1:100 (40x lens).)

product-image-AAA281230_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using HMGCR antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-HMGCR antibody
HMG-CoA reductase is the rate-limiting enzyme for cholesterol synthesis and is regulated via a negative feedback mechanism mediated by sterols and non-sterol metabolites derived from mevalonate, the product of the reaction catalyzed by reductase. Normally in mammalian cells this enzyme is suppressed by cholesterol derived from the internalization and degradation of low density lipoprotein (LDL) via the LDL receptor. Competitive inhibitors of the reductase induce the expression of LDL receptors in the liver, which in turn increases the catabolism of plasma LDL and lowers the plasma concentration of cholesterol, an important determinant of atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HMGCR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa/97kDa/99kDa
NCBI Official Full Name
3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform 1
NCBI Official Synonym Full Names
3-hydroxy-3-methylglutaryl-CoA reductase
NCBI Official Symbol
HMGCR
NCBI Official Synonym Symbols
LDLCQ3
NCBI Protein Information
3-hydroxy-3-methylglutaryl-Coenzyme A reductase
UniProt Protein Name
3-hydroxy-3-methylglutaryl-coenzyme A reductase
UniProt Gene Name
HMGCR
UniProt Synonym Gene Names
HMG-CoA reductase

Similar Products

Product Notes

The HMGCR hmgcr (Catalog #AAA281230) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGCR Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HMGCR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HMGCR hmgcr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARLQKLHTSI AGRNLYIRFQ SRSGDAMGMN MISKGTEKAL SKLHEYFPEM QILAVSGNYC TDKKPAAINW IEGRGKSVVC EAVIPAKVVR EVLKTTTEAM IEVNINKNLV GSAMAGSIGG YNAHAANIVT AIYIACGQDA AQNVGSSNCI TLMEASGPTN EDLYISCTMP SIEIGTVGGG TNLLPQQACL QMLGVQGACK DNPGENARQL ARIVCGTVMA GELSLMAALA AGHLVKSHMI HNRSKINLQD LQGAC. It is sometimes possible for the material contained within the vial of "HMGCR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.