Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23401_WB6.jpg WB (Western Blot) (WB Suggested Anti-HNF4A antibody Titration: 1 ug/mLSample Type: Human Liver)

Rabbit HNF4A Polyclonal Antibody | anti-HNF4A antibody

HNF4A Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HNF4A; TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HNF4A, Antibody; HNF4A Antibody - N-terminal region; anti-HNF4A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
Sequence Length
474
Applicable Applications for anti-HNF4A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HNF4A antibody Titration: 1 ug/mLSample Type: Human Liver)

product-image-AAA23401_WB6.jpg WB (Western Blot) (WB Suggested Anti-HNF4A antibody Titration: 1 ug/mLSample Type: Human Liver)

WB (Western Blot)

(WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

product-image-AAA23401_WB5.jpg WB (Western Blot) (WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

WB (Western Blot)

(Host: RatTarget Name: HNF4ASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23401_WB4.jpg WB (Western Blot) (Host: RatTarget Name: HNF4ASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HNF4ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23401_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: HNF4ASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HNF4ASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23401_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: HNF4ASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HNF4ASample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA23401_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: HNF4ASample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HNF4A antibody
This is a rabbit polyclonal antibody against HNF4A. It was validated on Western Blot

Target Description: The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
hepatocyte nuclear factor 4-alpha isoform 2
NCBI Official Synonym Full Names
hepatocyte nuclear factor 4 alpha
NCBI Official Symbol
HNF4A
NCBI Official Synonym Symbols
TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
NCBI Protein Information
hepatocyte nuclear factor 4-alpha
UniProt Protein Name
Hepatocyte nuclear factor 4-alpha
UniProt Gene Name
HNF4A
UniProt Synonym Gene Names
HNF4; NR2A1; TCF14; HNF-4-alpha; TCF-14
UniProt Entry Name
HNF4A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNF4A hnf4a (Catalog #AAA23401) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNF4A Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HNF4A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HNF4A hnf4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRLSKTLVDM DMADYSAALD PAYTTLEFEN VQVLTMGNDT SPSEGTNLNA. It is sometimes possible for the material contained within the vial of "HNF4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.