Rabbit HNRPA3 Polyclonal Antibody | anti-HNRPA3 antibody
HNRPA3 antibody
Gene Names
HNRNPA3; FBRNP; HNRPA3; D10S102; 2610510D13Rik
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
HNRPA3, Antibody; HNRPA3 antibody; Polyclonal HNRPA3; Anti-HNRPA3; HNRPA3; HNRPA 3; HNRPA-3; Heterogeneous Nuclear Ribonucleoprotein A3; anti-HNRPA3 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
HNRPA3 antibody was raised against the N terminal of HNRPA3
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
378
Applicable Applications for anti-HNRPA3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-HNRPA3 antibody
Rabbit polyclonal HNRPA3 antibody raised against the N terminal of HNRPA3
Product Categories/Family for anti-HNRPA3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A3
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A3
NCBI Official Symbol
HNRNPA3
NCBI Official Synonym Symbols
FBRNP; HNRPA3; D10S102; 2610510D13Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A3
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A3
UniProt Gene Name
HNRNPA3
UniProt Synonym Gene Names
HNRPA3; hnRNP A3
UniProt Entry Name
ROA3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HNRPA3 hnrnpa3 (Catalog #AAA224457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPA3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HNRPA3 hnrnpa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
