Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224457_IHC13.jpg IHC (Immunohiostchemistry) (HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)

Rabbit HNRPA3 Polyclonal Antibody | anti-HNRPA3 antibody

HNRPA3 antibody

Average rating 0.0
No ratings yet
Gene Names
HNRNPA3; FBRNP; HNRPA3; D10S102; 2610510D13Rik
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
HNRPA3, Antibody; HNRPA3 antibody; Polyclonal HNRPA3; Anti-HNRPA3; HNRPA3; HNRPA 3; HNRPA-3; Heterogeneous Nuclear Ribonucleoprotein A3; anti-HNRPA3 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Specificity
HNRPA3 antibody was raised against the N terminal of HNRPA3
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HNRPA3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
378
Applicable Applications for anti-HNRPA3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)

product-image-AAA224457_IHC13.jpg IHC (Immunohiostchemistry) (HNRPA3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)

WB (Western Blot)

(HNRPA3 antibody (AAA224457) used at 1.25 ug/ml to detect target protein.)

product-image-AAA224457_WB15.jpg WB (Western Blot) (HNRPA3 antibody (AAA224457) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-HNRPA3 antibody
Rabbit polyclonal HNRPA3 antibody raised against the N terminal of HNRPA3
Product Categories/Family for anti-HNRPA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A3
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A3
NCBI Official Symbol
HNRNPA3
NCBI Official Synonym Symbols
FBRNP; HNRPA3; D10S102; 2610510D13Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A3
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A3
UniProt Gene Name
HNRNPA3
UniProt Synonym Gene Names
HNRPA3; hnRNP A3
UniProt Entry Name
ROA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNRPA3 hnrnpa3 (Catalog #AAA224457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPA3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HNRPA3 hnrnpa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.