Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46338_IHC8.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IDH1 Polyclonal Antibody | anti-IDH1 antibody

Anti-IDH1 Antibody

Average rating 0.0
No ratings yet
Gene Names
IDH1; IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
IDH1, Antibody; Anti-IDH1 Antibody; Isocitrate dehydrogenase [NADP] cytoplasmic; Cytosolic NADP isocitrate dehydrogenase; Cytosolic NADP-isocitrate dehydrogenase; Epididymis luminal protein 216; Epididymis secretory protein Li 26; HEL-216; HEL-S-26; ICDH; IDCD; IDH; IDH1; IDHC_HUMAN; IDP; IDPC; Isocitrate dehydrogenase 1 (NADP+) soluble; NADP dependent isocitrate dehydrogenase cytosolic; NADP dependent isocitrate dehydrogenase peroxisomal; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; PICD; isocitrate dehydrogenase 1 (NADP+), soluble; anti-IDH1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
414
Applicable Applications for anti-IDH1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46338_IHC8.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46338_IHC10.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Rat Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46338_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Rat Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46338_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of IDH1 using anti-IDH1 antibody (AAA46338).IDH1 was detected in paraffin-embedded section of Mouse Testis Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-IDH1 Antibody (AAA46338) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of IDH1 using anti-IDH1 antibody (AAA46338).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Lung Tissue Lysate,Lane 2: Rat Kidney Tissue Lysate,Lane 3: Rat Brain Tissue Lysate,Lane 4: HELA Whole Cell Lysate,Lane 5: SMMC Whole Cell Lysate,Lane 6: A549 Whole Cell Lysate,Lane 7: NIH3T3 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IDH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IDH1 at approximately 47KD. The expected band size for IDH1 is at 47KD.)

product-image-AAA46338_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of IDH1 using anti-IDH1 antibody (AAA46338).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Lung Tissue Lysate,Lane 2: Rat Kidney Tissue Lysate,Lane 3: Rat Brain Tissue Lysate,Lane 4: HELA Whole Cell Lysate,Lane 5: SMMC Whole Cell Lysate,Lane 6: A549 Whole Cell Lysate,Lane 7: NIH3T3 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IDH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for IDH1 at approximately 47KD. The expected band size for IDH1 is at 47KD.)
Related Product Information for anti-IDH1 antibody
Description: Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human;Mouse; Rat.

Background: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
References
1. "Entrez Gene: Isocitrate dehydrogenase 1 (NADP+), soluble". 2. Watanabe T, Nobusawa S, Kleihues P, Ohgaki H (April 2009). "IDH1 mutations are early events in the development of astrocytomas and oligodendrogliomas.". Am J Pathol. 174 issue = 4 (4): 1149-53.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,659 Da
NCBI Official Full Name
isocitrate dehydrogenase
NCBI Official Synonym Full Names
isocitrate dehydrogenase (NADP(+)) 1, cytosolic
NCBI Official Symbol
IDH1
NCBI Official Synonym Symbols
IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
NCBI Protein Information
isocitrate dehydrogenase [NADP] cytoplasmic
UniProt Protein Name
Isocitrate dehydrogenase [NADP] cytoplasmic
UniProt Gene Name
IDH1
UniProt Synonym Gene Names
PICD; IDH
UniProt Entry Name
IDHC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IDH1 idh1 (Catalog #AAA46338) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-IDH1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IDH1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the IDH1 idh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IDH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.