Rabbit IGF2 Polyclonal Antibody | anti-IGF2 antibody
IGF2 antibody - C-terminal region
Gene Names
IGF2; GRDF; IGF-II; PP9974; C11orf43
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IGF2, Antibody; IGF2 antibody - C-terminal region; anti-IGF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQD
Sequence Length
236
Applicable Applications for anti-IGF2 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Goat: 93%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 85%; Rat: 92%; Sheep: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-IGF2 antibody
This is a rabbit polyclonal antibody against IGF2. It was validated on Western Blot
Target Description: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-IGF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25kDa
NCBI Official Full Name
insulin-like growth factor II isoform 2
NCBI Official Synonym Full Names
insulin like growth factor 2
NCBI Official Symbol
IGF2
NCBI Official Synonym Symbols
GRDF; IGF-II; PP9974; C11orf43
NCBI Protein Information
insulin-like growth factor II
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IGF2 (Catalog #AAA200358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGF2 antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IGF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IGF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDTWKQSTQR LRRGLPALLR ARRGHVLAKE LEAFREAKRH RPLIALPTQD. It is sometimes possible for the material contained within the vial of "IGF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
