Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46482_WB15.jpg WB (Western Blot) (Anti- Involucrin Picoband antibody, AAA46482, Western blottingAll lanes: Anti Involucrin (AAA46482) at 0.5ug/mlLane 1: A431 Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD)

anti-Human Involucrin Polyclonal Antibody | anti-IVL antibody

Anti-Involucrin Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Involucrin, Antibody; Anti-Involucrin Antibody; Involucrin; INVO_HUMAN; IVL; involucrin; anti-IVL antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
585
Applicable Applications for anti-IVL antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- Involucrin Picoband antibody, AAA46482, Western blottingAll lanes: Anti Involucrin (AAA46482) at 0.5ug/mlLane 1: A431 Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD)

product-image-AAA46482_WB15.jpg WB (Western Blot) (Anti- Involucrin Picoband antibody, AAA46482, Western blottingAll lanes: Anti Involucrin (AAA46482) at 0.5ug/mlLane 1: A431 Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD)
Related Product Information for anti-IVL antibody
Description: Rabbit IgG polyclonal antibody for Involucrin(IVL) detection. Tested with WB in Human.

Background: Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath theplasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by thetransglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.
References
1. Djian P, Phillips M, Easley K, Huang E, Simon M, Rice RH, Green H (November 1993). "The involucrin genes of the mouse and the rat: study of their shared repeats". Mol. Biol. Evol. 10 (6): 1136-49. 2. Eckert RL, Green H (Sep 1986). "Structure and evolution of the human involucrin gene". Cell 46 (4): 583-9. 3. Green H, Djian P (November 1992). "Consecutive actions of different gene-altering mechanisms in the evolution of involucrin". Mol. Biol. Evol. 9 (6): 977-1017. 

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
involucrin
NCBI Official Synonym Full Names
involucrin
NCBI Official Symbol
IVL
NCBI Protein Information
involucrin
UniProt Protein Name
Involucrin
UniProt Gene Name
IVL
UniProt Entry Name
INVO_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IVL ivl (Catalog #AAA46482) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Involucrin Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Involucrin can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IVL ivl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Involucrin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.