WB (Western Blot)
(Sample type: human microvascular endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
Rabbit ITGB3 Polyclonal Antibody | anti-ITGB3 antibody
ITGB3 antibody - N-terminal region
Gene Names
ITGB3; GT; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGB3, Antibody; ITGB3 antibody - N-terminal region; anti-ITGB3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVT
Sequence Length
788
Applicable Applications for anti-ITGB3 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 92%; Sheep: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Sample type: human microvascular endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
WB (Western Blot)
(Sample type: human microvascular endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
WB (Western Blot)
(Sample type: human aveolar basal endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
WB (Western Blot)
(Sample type: human aveolar basal endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
WB (Western Blot)
(ITGB3 antibody - N-terminal region validated by WB using Placenta Lysate at 1 ug/ml.)
WB (Western Blot)
(ITGB3 antibody - N-terminal region validated by WB using Placenta Lysate at 1 ug/ml.)
Related Product Information for anti-ITGB3 antibody
This is a rabbit polyclonal antibody against ITGB3. It was validated on Western Blot
Target Description: The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.
Target Description: The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.
Product Categories/Family for anti-ITGB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
integrin beta-3
NCBI Official Synonym Full Names
integrin subunit beta 3
NCBI Official Symbol
ITGB3
NCBI Official Synonym Symbols
GT; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16
NCBI Protein Information
integrin beta-3
UniProt Protein Name
Integrin beta-3
UniProt Gene Name
ITGB3
UniProt Synonym Gene Names
GP3A; GPIIIa
UniProt Entry Name
ITB3_HUMAN
Similar Products
Product Notes
The ITGB3 itgb3 (Catalog #AAA201218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ITGB3 itgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLGSPRCDLK ENLLKDNCAP ESIEFPVSEA RVLEDRPLSD KGSGDSSQVT. It is sometimes possible for the material contained within the vial of "ITGB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.