Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197927_WB13.jpg WB (Western Blot) (WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit KCNQ4 Polyclonal Antibody | anti-KCNQ4 antibody

KCNQ4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
KCNQ4; DFNA2; KV7.4; DFNA2A
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested: Human, Hamster
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNQ4, Antibody; KCNQ4 antibody - middle region; anti-KCNQ4 antibody
Ordering
Host
Rabbit
Reactivity
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested: Human, Hamster
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ
Sequence Length
695
Applicable Applications for anti-KCNQ4 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNQ4
Protein Size
695 amino acids
Protein Interactions
STIP1; STUB1; HSP90B1; HSP90AA1; HSPA8; DNAJA1; KCNQ3
Preparation and Storage
For short term use, store at 2-8°C up to 1 week.
For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

product-image-AAA197927_WB13.jpg WB (Western Blot) (WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

WB (Western Blot)

(Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:KCNQ4Submitted by:Anonymous)

product-image-AAA197927_WB15.jpg WB (Western Blot) (Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:KCNQ4Submitted by:Anonymous)
Related Product Information for anti-KCNQ4 antibody
This is a rabbit polyclonal antibody against KCNQ4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KCNQ4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily KQT member 4 isoform a
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily Q member 4
NCBI Official Symbol
KCNQ4
NCBI Official Synonym Symbols
DFNA2; KV7.4; DFNA2A
NCBI Protein Information
potassium voltage-gated channel subfamily KQT member 4
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 4
UniProt Gene Name
KCNQ4
UniProt Entry Name
KCNQ4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KCNQ4 kcnq4 (Catalog #AAA197927) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNQ4 antibody - middle region reacts with Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat Tested: Human, Hamster and may cross-react with other species as described in the data sheet. AAA Biotech's KCNQ4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the KCNQ4 kcnq4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSRMGIKDRI RMGSSQRRTG PSKQHLAPPT MPTSPSSEQV GEATSPTKVQ. It is sometimes possible for the material contained within the vial of "KCNQ4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.