Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23498_WB6.jpg WB (Western Blot) (WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit KRT8 Polyclonal Antibody | anti-KRT8 antibody

KRT8 Antibody

Gene Names
KRT8; K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KRT8, Antibody; KRT8 Antibody; anti-KRT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
Sequence Length
483
Applicable Applications for anti-KRT8 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA23498_WB6.jpg WB (Western Blot) (WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Small intestine)

product-image-AAA23498_IHC5.jpg IHC (Immunohistochemistry) (Small intestine)

IHC (Immunohistochemistry)

(Rabbit Anti-KRT8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23498_IHC4.jpg IHC (Immunohistochemistry) (Rabbit Anti-KRT8 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-KRT8 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23498_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-KRT8 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(KRT8 Antibody Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

product-image-AAA23498_IHC2.jpg IHC (Immunohistochemistry) (KRT8 Antibody Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and membrane of hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Sample Type: HumanSample Type: Human Triple Negative Breast Cancer XenograftsPrimary Dilution: 1:100Secondary (Anti-Rabbit 594) Dilution: 1:200)

product-image-AAA23498_IHC.jpg IHC (Immunohistochemistry) (Sample Type: HumanSample Type: Human Triple Negative Breast Cancer XenograftsPrimary Dilution: 1:100Secondary (Anti-Rabbit 594) Dilution: 1:200)
Related Product Information for anti-KRT8 antibody
This is a rabbit polyclonal antibody against KRT8. It was validated on Western Blot and immunohistochemistry

Target Description: KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Product Categories/Family for anti-KRT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
keratin, type II cytoskeletal 8 isoform 2
NCBI Official Synonym Full Names
keratin 8
NCBI Official Symbol
KRT8
NCBI Official Synonym Symbols
K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
NCBI Protein Information
keratin, type II cytoskeletal 8
UniProt Protein Name
Keratin, type II cytoskeletal 8
UniProt Gene Name
KRT8
UniProt Synonym Gene Names
CYK8; CK-8; K8
UniProt Entry Name
K2C8_HUMAN

Similar Products

Product Notes

The KRT8 krt8 (Catalog #AAA23498) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT8 Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's KRT8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the KRT8 krt8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSIRVTQKSY KVSTSGPRAF SSRSYTSGPG SRISSSSFSR VGSSNFRGGL. It is sometimes possible for the material contained within the vial of "KRT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.