Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282283_IF13.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of U2OS cells using LAMTOR1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human LAMTOR1 Polyclonal Antibody | anti-LAMTOR1 antibody

LAMTOR1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
SOD2; IPOB; MNSOD; MVCD6
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
LAMTOR1, Antibody; LAMTOR1 Rabbit pAb; LAMTOR1; C11orf59; PDRO; Ragulator1; p18; p27RF-Rho; ragulator complex protein LAMTOR1; anti-LAMTOR1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Applicable Applications for anti-LAMTOR1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human LAMTOR1 (NP_060377.1).
Cellular Location
Cell membrane, Cytoplasmic side, Late endosome membrane, Lipid-anchor, Lysosome membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Confocal immunofluorescence analysis of U2OS cells using LAMTOR1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282283_IF13.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of U2OS cells using LAMTOR1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using LAMTOR1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

product-image-AAA282283_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using LAMTOR1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-LAMTOR1 antibody
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. LAMTOR1 is directly responsible for anchoring the Ragulator complex to membranes. Also required for late endosomes/lysosomes biogenesis it may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes. May be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes. May also play a role in RHOA activation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
222
NCBI Official Full Name
Superoxide dismutase
NCBI Official Synonym Full Names
superoxide dismutase 2, mitochondrial
NCBI Official Symbol
SOD2
NCBI Official Synonym Symbols
IPOB; MNSOD; MVCD6
NCBI Protein Information
superoxide dismutase [Mn], mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase
UniProt Protein Name
Superoxide dismutase [Mn], mitochondrial
UniProt Gene Name
SOD2
UniProt Entry Name
SODM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LAMTOR1 sod2 (Catalog #AAA282283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAMTOR1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAMTOR1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the LAMTOR1 sod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KHSLPDLPYD YGALEPHINA QIMQLHHSKH HAAYVNNLNV TEEKYQEALA KGDVTAQIAL QPALKFNGGG HINHSIFWTN LSPNGGGEPK GELLEAIKRD FGSFDKFKEK LTAASVGVQG SGWGWLGFNK ERGHLQIAAC PNQDPLQGTT GLIPLLGIDV WEHAYYLQYK NVRPDYLKAI WNVINWENVT ERYMACKK. It is sometimes possible for the material contained within the vial of "LAMTOR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.