Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281735_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using LRRFIP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit LRRFIP2 Polyclonal Antibody | anti-LRRFIP2 antibody

LRRFIP2 Rabbit pAb

Gene Names
LRRFIP2; HUFI-2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
LRRFIP2, Antibody; LRRFIP2 Rabbit pAb; LRRFIP2; HUFI-2; anti-LRRFIP2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
VIEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRY
Applicable Applications for anti-LRRFIP2 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 150-340 of human LRRFIP2 (NP_060194.1).
Positive Samples
Mouse heart, Mouse skeletal muscle, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using LRRFIP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281735_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using LRRFIP2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using LRRFIP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA281735_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using LRRFIP2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-LRRFIP2 antibody
Background: The protein encoded by this gene, along with MYD88, binds to the cytosolic tail of toll-like receptor 4 (TLR4), which results in activation of nuclear factor kappa B signaling. The ubiquitin-like protein FAT10 prevents the interaction of the encoded protein and TLR4, thereby inactivating the nuclear factor kappa B signaling pathway. In addition, this protein can downregulate the NLRP3 inflammasome by recruiting the caspase-1 inhibitor Flightless-I to the inflammasome complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leucine-rich repeat flightless-interacting protein 2 isoform 1
NCBI Official Synonym Full Names
leucine rich repeat (in FLII) interacting protein 2
NCBI Official Symbol
LRRFIP2
NCBI Official Synonym Symbols
HUFI-2
NCBI Protein Information
leucine-rich repeat flightless-interacting protein 2; LRR FLII-interacting protein 2
UniProt Protein Name
Leucine-rich repeat flightless-interacting protein 2
UniProt Gene Name
LRRFIP2
UniProt Synonym Gene Names
LRR FLII-interacting protein 2
UniProt Entry Name
LRRF2_HUMAN

Similar Products

Product Notes

The LRRFIP2 lrrfip2 (Catalog #AAA281735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRFIP2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRRFIP2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the LRRFIP2 lrrfip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VIEEQEEQMA EFYRENEEKS KELERQKHMC SVLQHKMEEL KEGLRQRDEL IEKHGLVIIP DGTPNGDVSH EPVAGAITVV SQEAAQVLES AGEGPLDVRL RKLAGEKEEL LSQIRKLKLQ LEEERQKCSR NDGTVGDLAG LQNGSDLQFI EMQRDANRQI SEYKFKLSKA EQDITTLEQS ISRLEGQVLR Y. It is sometimes possible for the material contained within the vial of "LRRFIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.