Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit LRRK2 Polyclonal Antibody | anti-LRRK2 antibody

LRRK2 Rabbit pAb

Gene Names
LRRK2; PARK8; RIPK7; ROCO2; AURA17; DARDARIN
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
LRRK2; Polyclonal Antibody; LRRK2 Rabbit pAb; AURA17; DARDARIN; PARK8; RIPK7; ROCO2; anti-LRRK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
ITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE
Applicable Applications for anti-LRRK2 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2355-2527 of human LRRK2 (NP_940980.3).
Cellular Location
Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Endosome, Golgi apparatus, Lysosome, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix, Mitochondrion outer membrane, Perikaryon, Peripheral membrane protein, axon, dendrite, secretory vesicle, synaptic vesicle membrane
Positive Samples
HepG2, Mouse kidney, Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C2C12 cells using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of C2C12 cells using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human placenta using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human placenta using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Rat brain using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Rat brain using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Mouse kidney using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Mouse kidney using LRRK2 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using LRRK2 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot) (Western blot analysis of extracts of various cell lines, using LRRK2 Polyclonal Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-LRRK2 antibody
Background: This gene is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane. Mutations in this gene have been associated with Parkinson disease-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
2527
NCBI Official Full Name
leucine-rich repeat serine/threonine-protein kinase 2
NCBI Official Synonym Full Names
leucine-rich repeat kinase 2
NCBI Official Symbol
LRRK2
NCBI Official Synonym Symbols
PARK8; RIPK7; ROCO2; AURA17; DARDARIN
NCBI Protein Information
leucine-rich repeat serine/threonine-protein kinase 2; augmented in rheumatoid arthritis 17
UniProt Protein Name
Leucine-rich repeat serine/threonine-protein kinase 2
UniProt Gene Name
LRRK2
UniProt Synonym Gene Names
PARK8
UniProt Entry Name
LRRK2_HUMAN

Similar Products

Product Notes

The LRRK2 lrrk2 (Catalog #AAA28347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRK2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRRK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the LRRK2 lrrk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ITVVVDTALY IAKQNSPVVE VWDKKTEKLC GLIDCVHFLR EVMVKENKES KHKMSYSGRV KTLCLQKNTA LWIGTGGGHI LLLDLSTRRL IRVIYNFCNS VRVMMTAQLG SLKNVMLVLG YNRKNTEGTQ KQKEIQSCLT VWDINLPHEV QNLEKHIEVR KELAEKMRRT SVE. It is sometimes possible for the material contained within the vial of "LRRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.