Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199271_WB13.jpg WB (Western Blot) (WB Suggested Anti-M6PR Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit M6PR Polyclonal Antibody | anti-M6PR antibody

M6PR antibody - N-terminal region

Gene Names
M6PR; SMPR; MPR46; CD-MPR; MPR 46; MPR-46; CD-M6PR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
M6PR, Antibody; M6PR antibody - N-terminal region; anti-M6PR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
Sequence Length
277
Applicable Applications for anti-M6PR antibody
WB (Western Blot)
Homology
Cow: 85%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human M6PR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-M6PR Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199271_WB13.jpg WB (Western Blot) (WB Suggested Anti-M6PR Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

WB (Western Blot)

(Human, Mouse)

product-image-AAA199271_WB15.jpg WB (Western Blot) (Human, Mouse)
Related Product Information for anti-M6PR antibody
This is a rabbit polyclonal antibody against M6PR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.The protein encoded by this gene is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.
Product Categories/Family for anti-M6PR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
cation-dependent mannose-6-phosphate receptor isoform 1
NCBI Official Synonym Full Names
mannose-6-phosphate receptor, cation dependent
NCBI Official Symbol
M6PR
NCBI Official Synonym Symbols
SMPR; MPR46; CD-MPR; MPR 46; MPR-46; CD-M6PR
NCBI Protein Information
cation-dependent mannose-6-phosphate receptor
UniProt Protein Name
Cation-dependent mannose-6-phosphate receptor
UniProt Gene Name
M6PR
UniProt Synonym Gene Names
MPR46; MPRD; CD Man-6-P receptor; CD-MPR; MPR 46

Similar Products

Product Notes

The M6PR m6pr (Catalog #AAA199271) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The M6PR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's M6PR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the M6PR m6pr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLKPLFNKSF ESTVGQGSDT YIYIFRVCRE AGNHTSGAGL VQINKSNGKE. It is sometimes possible for the material contained within the vial of "M6PR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.