WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and MAD1/MAD1L1 Rabbit pAb knockdown (KD) 293T cells, using MAD1/MAD1L1 Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Human MAD1/MAD1L1 Polyclonal Antibody | anti-MAD1/MAD1L1 antibody
[KD Validated] MAD1/MAD1L1 Rabbit pAb
Gene Names
STRADA; LYK5; PMSE; Stlk; STRAD; NY-BR-96
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
MAD1/MAD1L1, Antibody; [KD Validated] MAD1/MAD1L1 Rabbit pAb; MAD1L1; MAD1; PIG9; TP53I9; TXBP181; anti-MAD1/MAD1L1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
FLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPE
Applicable Applications for anti-MAD1/MAD1L1 antibody
WB (Western Blot)
Positive Samples
293T, HepG2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 351-718 of human MAD1/MAD1L1 (NP_003541.2).
Cellular Location
centrosome, cytoplasm, cytosol, mitotic spindle, mitotic spindle assembly checkpoint MAD1-MAD2 complex, nuclear pore nuclear basket, nucleus, spindle, spindle pole
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and MAD1/MAD1L1 Rabbit pAb knockdown (KD) 293T cells, using MAD1/MAD1L1 Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and MAD1/MAD1L1 Rabbit pAb knockdown (KD) 293T cells, using MAD1/MAD1L1 Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of HepG2, using MAD1/MAD1L1 Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of HepG2, using MAD1/MAD1L1 Rabbit pAb antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-MAD1/MAD1L1 antibody
MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MAD1/MAD1L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,369 Da
NCBI Official Full Name
STE20-related kinase adapter protein alpha isoform 2
NCBI Official Synonym Full Names
STE20-related kinase adaptor alpha
NCBI Official Symbol
STRADA
NCBI Official Synonym Symbols
LYK5; PMSE; Stlk; STRAD; NY-BR-96
NCBI Protein Information
STE20-related kinase adapter protein alpha; STRAD alpha; protein kinase LYK5; STE20-like pseudokinase; serologically defined breast cancer antigen NY-BR-96
UniProt Protein Name
STE20-related kinase adapter protein alpha
UniProt Gene Name
STRADA
UniProt Synonym Gene Names
LYK5; STRAD; STRAD alpha
UniProt Entry Name
STRAA_HUMAN
Similar Products
Product Notes
The MAD1/MAD1L1 strada (Catalog #AAA282202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] MAD1/MAD1L1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAD1/MAD1L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAD1/MAD1L1 strada for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FLPEGGCYEL LTVIGKGFED LMTVNLARYK PTGEYVTVRR INLEACSNEM VTFLQGELHV SKLFNHPNIV PYRATFIADN ELWVVTSFMA YGSAKDLICT HFMDGMNELA IAYILQGVLK ALDYIHHMGY VHRSVKASHI LISVDGKVYL SGLRSNLSMI SHGQRQRVVH DFPKYSVKVL PWLSPE. It is sometimes possible for the material contained within the vial of "MAD1/MAD1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.