WB (Western Blot)
(WB Suggested Anti-MAGED1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellMAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit MAGED1 Polyclonal Antibody | anti-MAGED1 antibody
MAGED1 antibody - C-terminal region
Gene Names
MAGED1; NRAGE; DLXIN-1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAGED1, Antibody; MAGED1 antibody - C-terminal region; anti-MAGED1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV
Sequence Length
778
Applicable Applications for anti-MAGED1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-MAGED1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellMAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-MAGED1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellMAGED1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(Host: MouseTarget Name: MAGED1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: MAGED1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAGED1 antibody
This is a rabbit polyclonal antibody against MAGED1. It was validated on Western Blot
Target Description: This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.
Target Description: This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-MAGED1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
melanoma-associated antigen D1 isoform b
NCBI Official Synonym Full Names
MAGE family member D1
NCBI Official Symbol
MAGED1
NCBI Official Synonym Symbols
NRAGE; DLXIN-1
NCBI Protein Information
melanoma-associated antigen D1
UniProt Protein Name
Melanoma-associated antigen D1
UniProt Gene Name
MAGED1
UniProt Synonym Gene Names
NRAGE
UniProt Entry Name
MAGD1_HUMAN
Similar Products
Product Notes
The MAGED1 maged1 (Catalog #AAA201265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAGED1 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAGED1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAGED1 maged1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACFVLEKKFG IQLKEIDKEE HLYILISTPE SLAGILGTTK DTPKLGLLLV. It is sometimes possible for the material contained within the vial of "MAGED1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.