Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201008_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAPKAPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit MAPKAPK2 Polyclonal Antibody | anti-MAPKAPK2 antibody

MAPKAPK2 antibody - middle region

Gene Names
MAPKAPK3; 3PK; MK-3; MDPT3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MAPKAPK2, Antibody; MAPKAPK2 antibody - middle region; anti-MAPKAPK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
Sequence Length
370
Applicable Applications for anti-MAPKAPK2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAPKAPK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAPKAPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA201008_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAPKAPK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: MAPKAPK3Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA201008_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: MAPKAPK3Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-MAPKAPK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201008_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MAPKAPK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MAPKAPK2 antibody
This is a rabbit polyclonal antibody against MAPKAPK2. It was validated on Western Blot

Target Description: MAPKAPK2 is a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
MAP kinase-activated protein kinase 3
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 3
NCBI Official Symbol
MAPKAPK3
NCBI Official Synonym Symbols
3PK; MK-3; MDPT3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
NCBI Protein Information
MAP kinase-activated protein kinase 3
UniProt Protein Name
MAP kinase-activated protein kinase 3
UniProt Gene Name
MAPKAPK3
UniProt Synonym Gene Names
MAPK-activated protein kinase 3; MAPKAP kinase 3; MAPKAP-K3; MAPKAPK-3; MK-3; 3pK
UniProt Entry Name
MAPK3_HUMAN

Similar Products

Product Notes

The MAPKAPK2 mapkapk3 (Catalog #AAA201008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPKAPK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAPK2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MAPKAPK2 mapkapk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLTDFGFAKE TTQNALQTPC YTPYYVAPEV LGPEKYDKSC DMWSLGVIMY. It is sometimes possible for the material contained within the vial of "MAPKAPK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.