Rabbit MCTP1 Polyclonal Antibody | anti-MCTP1 antibody
MCTP1 antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
MCTP1, Antibody; MCTP1 antibody; Polyclonal MCTP1; Anti-MCTP1; Multiple C2 Domains Transmembrane 1; MCTP1; MCTP 1; MCTP-1; FLJ22344; anti-MCTP1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
MCTP1 antibody was raised against the middle region of MCTP1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCTP1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
600
Applicable Applications for anti-MCTP1 antibody
WB (Western Blot)
Biological Significance
MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.
Cross-Reactivity
Human
Immunogen
MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-MCTP1 antibody
Rabbit polyclonal MCTP1 antibody raised against the middle region of MCTP1
Product Categories/Family for anti-MCTP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
89 kDa (MW of target protein)
NCBI Official Full Name
MCTP1 protein
NCBI Official Synonym Full Names
multiple C2 domains, transmembrane 1
NCBI Official Symbol
MCTP1
NCBI Protein Information
multiple C2 and transmembrane domain-containing protein 1
UniProt Protein Name
Multiple C2 and transmembrane domain-containing protein 1
UniProt Gene Name
MCTP1
UniProt Entry Name
MCTP1_HUMAN
Similar Products
Product Notes
The MCTP1 mctp1 (Catalog #AAA224421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MCTP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MCTP1 mctp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCTP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
