Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19248_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

Rabbit anti-Human METTL3 Polyclonal Antibody | anti-METTL3 antibody

Anti-METTL3 Antibody

Average rating 0.0
No ratings yet
Gene Names
METTL3; M6A; IME4; Spo8; MT-A70
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay, ELISA
Purity
Immunogen affinity purified.
Synonyms
METTL3, Antibody; Anti-METTL3 Antibody; N6-adenosine-methyltransferase catalytic subunit; methyltransferase like 3 ; anti-METTL3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for METTL3 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.005mg NaN3.
Applicable Applications for anti-METTL3 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry), ELISA (Direct ELISA)
Application Notes
WB: 0.1-0.25ug/ml|Human|
IHC-P: 2-5ug/ml|Human|
ICC/IF: 5ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Human|
Direct ELISA: 0.1-0.5ug/ml|Human|
Immunogen
A synthetic peptide corresponding to a sequence of human METTL3 (HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19248_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of THP-1 cells using anti-METTL3 antibody (AAA19248).Overlay histogram showing THP-1 cells stained with AAA19248 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-METTL3 Antibody (AAA19248, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19248_FCM6.png FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of THP-1 cells using anti-METTL3 antibody (AAA19248).Overlay histogram showing THP-1 cells stained with AAA19248 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-METTL3 Antibody (AAA19248, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of METTL3 using anti-METTL3 antibody (AAA19248).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human PC-3 whole cell lysatesLane 2: human HEPG2 whole cell lysatesLane 3: human A549 whole cell lysatesLane 4: human HEK293 whole cell lysatesLane 5: human HELA whole cell lysatesLane 6: human CACO-2 whole cell lysatesLane 7: human K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-METTL3 antigen affinity purified polyclonal antibody (Catalog # AAA19248) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for METTL3 at approximately 75KD. The expected band size for METTL3 is at 75KD.)

product-image-AAA19248_WB5.jpg WB (Western Blot) (Figure 1. Western blot analysis of METTL3 using anti-METTL3 antibody (AAA19248).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human PC-3 whole cell lysatesLane 2: human HEPG2 whole cell lysatesLane 3: human A549 whole cell lysatesLane 4: human HEK293 whole cell lysatesLane 5: human HELA whole cell lysatesLane 6: human CACO-2 whole cell lysatesLane 7: human K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-METTL3 antigen affinity purified polyclonal antibody (Catalog # AAA19248) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for METTL3 at approximately 75KD. The expected band size for METTL3 is at 75KD.)

IF (Immunofluorescence)

(Figure 5. IF analysis of METTL3 using anti- METTL3 antibody (AAA19248).METTL3 was detected in immunocytochemical section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- METTL3 Antibody (AAA19248) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19248_IF4.jpg IF (Immunofluorescence) (Figure 5. IF analysis of METTL3 using anti- METTL3 antibody (AAA19248).METTL3 was detected in immunocytochemical section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti- METTL3 Antibody (AAA19248) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19248_IHC3.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19248_IHC2.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19248_IHC.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of METTL3 using anti-METTL3 antibody (AAA19248).METTL3 was detected in paraffin-embedded section of human ovarian cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-METTL3 Antibody (AAA19248) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)
Related Product Information for anti-METTL3 antibody
N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11. 2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
References
1. Alarcon, C. R., Lee, H., Goodarzi, H., Halberg, N., Tavazoie, S. F. N(6)-methyladenosine marks primary microRNAs for processing. Nature 519: 482-485, 2015.
2. Barbieri, I., Tzelepis, K., Pandolfini, L., Shi, J., Millan-Zambrano, G., Robson, S. C., Aspris, D., Migliori, V., Bannister, A. J., Han, N., De Braekeleer, E., Ponstingl, H., Hendrick, A., Vakoc, C. R., Vassiliou, G. S., Kouzarides, T. Promoter-bound METTL3 maintains myeloid leukaemia by m(6)A-dependent translation control. Nature 552: 126-131, 2017.
3. Bujnicki, J. M., Feder, M., Radlinska, M., Blumenthal, R. M. Structure prediction and phylogenetic analysis of a functionally diverse family of proteins homologous to the MT-A70 subunit of the human mRNA:m6A methyltransferase. J. Molec. Evol. 55: 431-444, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,479 Da
NCBI Official Full Name
N6-adenosine-methyltransferase 70 kDa subunit
NCBI Official Synonym Full Names
methyltransferase like 3
NCBI Official Symbol
METTL3
NCBI Official Synonym Symbols
M6A; IME4; Spo8; MT-A70
NCBI Protein Information
N6-adenosine-methyltransferase 70 kDa subunit; adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase; mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase; mRNA m(6)A methyltransferase; methyltransferase-like protein 3
UniProt Protein Name
N6-adenosine-methyltransferase 70 kDa subunit
UniProt Gene Name
METTL3
UniProt Synonym Gene Names
MTA70; MT-A70
UniProt Entry Name
MTA70_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The METTL3 mettl3 (Catalog #AAA19248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-METTL3 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's METTL3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry), ELISA (Direct ELISA). WB: 0.1-0.25ug/ml|Human| IHC-P: 2-5ug/ml|Human| ICC/IF: 5ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Human| Direct ELISA: 0.1-0.5ug/ml|Human|. Researchers should empirically determine the suitability of the METTL3 mettl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "METTL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.