Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200537_WB11.jpg WB (Western Blot) (WB Suggested Anti-MLH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit MLH1 Polyclonal Antibody | anti-MLH1 antibody

MLH1 antibody - N-terminal region

Gene Names
MLH1; FCC2; COCA2; HNPCC; hMLH1; HNPCC2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MLH1, Antibody; MLH1 antibody - N-terminal region; anti-MLH1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
Sequence Length
756
Applicable Applications for anti-MLH1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MLH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MLH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA200537_WB11.jpg WB (Western Blot) (WB Suggested Anti-MLH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

WB (Western Blot)

(Lanes:Lane1: hMLH1 tranfected 293 cellsPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:MLH1Submitted by:Galina Petukhova, USUHSMLH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA200537_WB13.jpg WB (Western Blot) (Lanes:Lane1: hMLH1 tranfected 293 cellsPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:MLH1Submitted by:Galina Petukhova, USUHSMLH1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: MouseTarget Name: MLH1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA200537_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: MLH1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-MLH1 antibody
This is a rabbit polyclonal antibody against MLH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC.This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Alternatively spliced transcript variants encoding different isoforms have been described, but their full-length natures have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MLH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
DNA mismatch repair protein Mlh1 isoform 1
NCBI Official Synonym Full Names
mutL homolog 1
NCBI Official Symbol
MLH1
NCBI Official Synonym Symbols
FCC2; COCA2; HNPCC; hMLH1; HNPCC2
NCBI Protein Information
DNA mismatch repair protein Mlh1
UniProt Protein Name
DNA mismatch repair protein Mlh1
UniProt Gene Name
MLH1
UniProt Synonym Gene Names
COCA2
UniProt Entry Name
MLH1_HUMAN

Similar Products

Product Notes

The MLH1 mlh1 (Catalog #AAA200537) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLH1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MLH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MLH1 mlh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MIENCLDAKS TSIQVIVKEG GLKLIQIQDN GTGIRKEDLD IVCERFTTSK. It is sometimes possible for the material contained within the vial of "MLH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.