Rabbit MMP9 Polyclonal Antibody | anti-MMP9 antibody

Anti-MMP9 Antibody

Cat. Num. AAA46650

• Reactivity: Mouse, Rat; No cross reactivity with other proteins.
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: MMP9, Antibody; Anti-MMP9 Antibody; 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GELB; Macrophage gelatinase; MANDP2; Matrix metalloproteinase 9; Matrix metalloproteinase9; Matrix metalloproteinase-9; MMP 9; mmp 9 kit; MMP9; MMP-9; P50282; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); anti-MMP9 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 708

• Applicable Applications for anti-MMP9 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(MMP-9 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- MMP-9 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(MMP-9 was detected in paraffin-embedded sections of mouse spleen tissues using rabbit anti- MMP-9 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of MMP-9 expression in NRK whole cell lysates (lane 1). MMP-9 at 78KD, 92KD was detected using rabbit anti- MMP-9 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Related Product Information for anti-MMP9 antibody

Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9 (MMP9) detection.
Background: Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

References

1. Template:, 92kDa type IV collagenase).
2. Yuichiro Hirose et al. (May 2008). "A Functional Polymorphism in THBS2 that Affects Alternative Splicing and MMP Binding Is Associated with Lumbar-Disc Herniation".

NCBI and Uniprot Product Information

• NCBI GI #: 13591993
• NCBI GeneID: 81687
• NCBI Accession #: NP_112317.1
• NCBI GenBank Nucleotide #: NM_031055.1
• UniProt Accession #: P50282
• Molecular Weight: 78,611 Da
• NCBI Official Full Name: matrix metalloproteinase-9
• NCBI Official Synonym Full Names: matrix metallopeptidase 9
• NCBI Official Symbol: Mmp9
• NCBI Protein Information: matrix metalloproteinase-9
• UniProt Protein Name: Matrix metalloproteinase-9
• UniProt Gene Name: Mmp9
• UniProt Synonym Gene Names: MMP-9; GELB
• UniProt Entry Name: MMP9_RAT