Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282334_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human prostate cancer using [KO Validated] MRP4/ABCC4 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit anti-Human MRP4/ABCC4 Polyclonal Antibody | anti-MRP4/ABCC4 antibody

MRP4/ABCC4 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
FKBP2; PPIase; FKBP-13
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
MRP4/ABCC4, Antibody; MRP4/ABCC4 Rabbit pAb; ABCC4; MOAT-B; MOATB; MRP4; multidrug resistance-associated protein 4; anti-MRP4/ABCC4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Applicable Applications for anti-MRP4/ABCC4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1067-1325 of human MRP4/ABCC4 (NP_005836.2).
Cellular Location
Membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human prostate cancer using [KO Validated] MRP4/ABCC4 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282334_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human prostate cancer using [KO Validated] MRP4/ABCC4 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human oophoroma using [KO Validated] MRP4/ABCC4 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282334_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human oophoroma using [KO Validated] MRP4/ABCC4 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-MRP4/ABCC4 antibody
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,649 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP2
NCBI Official Synonym Full Names
FK506 binding protein 2, 13kDa
NCBI Official Symbol
FKBP2
NCBI Official Synonym Symbols
PPIase; FKBP-13
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP2; 13 kDa FK506-binding protein; 13 kDa FKBP; FK506-binding protein 2 (13kD); FKBP-2; PPIase FKBP2; immunophilin FKBP13; proline isomerase; rapamycin-binding protein; rotamase
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP2
UniProt Gene Name
FKBP2
UniProt Synonym Gene Names
FKBP13; PPIase FKBP2; 13 kDa FKBP; FKBP-13; FKBP-2
UniProt Entry Name
FKBP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MRP4/ABCC4 fkbp2 (Catalog #AAA282334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRP4/ABCC4 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRP4/ABCC4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MRP4/ABCC4 fkbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATGAEGKRKL QIGVKKRVDH CPIKSRKGDV LHMHYTGKLE DGTEFDSSLP QNQPFVFSLG TGQVIKGWDQ GLLGMCEGEK RKLVIPSELG YGERGAPPKI PGGATLVFEV ELLKIERRTE L. It is sometimes possible for the material contained within the vial of "MRP4/ABCC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.