Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281653_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse testis using MSH6 antibody at dilution of 1:100 (40x lens).)

Rabbit MSH6 Polyclonal Antibody | anti-MSH6 antibody

MSH6 Rabbit pAb

Gene Names
MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
MSH6, Antibody; MSH6 Rabbit pAb; MSH6; GTBP; GTMBP; HNPCC5; HSAP; p160; anti-MSH6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGL
Applicable Applications for anti-MSH6 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human MSH6 (NP_000170.1).
Cellular Location
Chromosome, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse testis using MSH6 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281653_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse testis using MSH6 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat testis using MSH6 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281653_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat testis using MSH6 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-MSH6 antibody
Background: This gene encodes a member of the DNA mismatch repair MutS family. In E Coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
Product Categories/Family for anti-MSH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
1360
NCBI Official Full Name
DNA mismatch repair protein Msh6 isoform 1
NCBI Official Synonym Full Names
mutS homolog 6 (E. coli)
NCBI Official Symbol
MSH6
NCBI Official Synonym Symbols
GTBP; HSAP; p160; GTMBP; HNPCC5
NCBI Protein Information
DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein
UniProt Protein Name
DNA mismatch repair protein Msh6
UniProt Gene Name
MSH6
UniProt Synonym Gene Names
GTBP; hMSH6; GTBP; GTMBP; p160
UniProt Entry Name
MSH6_HUMAN

Similar Products

Product Notes

The MSH6 msh6 (Catalog #AAA281653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSH6 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MSH6 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MSH6 msh6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRQSTLYSF FPKSPALSDA NKASARASRE GGRAAAAPGA SPSPGGDAAW SEAGPGPRPL ARSASPPKAK NLNGGLRRSV APAAPTSCDF SPGDLVWAKM EGYPWWPCLV YNHPFDGTFI REKGKSVRVH VQFFDDSPTR GWVSKRLLKP YTGSKSKEAQ KGGHFYSAKP EILRAMQRAD EALNKDKIKR LELAVCDEPS EPEEEEEMEV GTTYVTDKSE EDNEIESEEE VQPKTQGSRR SSRQIKKRRV ISDSESDIGG SDVEFKPDTK EEGSSDEISS GVGDSESEGL. It is sometimes possible for the material contained within the vial of "MSH6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.