Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19262_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of C6 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing C6 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit non-muscle Myosin IIB/MYH10 Polyclonal Antibody | anti-MYH10 antibody

Anti-non-muscle Myosin IIB/MYH10 Antibody

Average rating 0.0
No ratings yet
Gene Names
MYH10; NMMHCB; NMMHC-IIB
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
non-muscle Myosin IIB/MYH10, Antibody; Anti-non-muscle Myosin IIB/MYH10 Antibody; Myosin-10; Cellular myosin heavy chain, type B; Myosin heavy chain 10; Myosin heavy chain, non-muscle IIb; Non-muscle myosin heavy chain B; NMMHC-B; Non-muscle myosin heavy chain IIb; NMMHC II-b; NMMHC-IIB; MYH10; myosin heavy chain 10; anti-MYH10 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for non-muscle Myosin IIB/MYH10 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Applicable Applications for anti-MYH10 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
WB: 0.1-0.25ug/ml|Human, Mouse, Rat|
IHC-P: 0.5-1ug/ml|Human, Rat|
ICC/IF: 4ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Human, Mouse, Rat|
Immunogen
A synthetic peptide corresponding to a sequence of human non-muscle Myosin IIB/MYH10 (QRTGLEDPERYLFVDRAVIYNPATQADWTAKK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 8. Flow Cytometry analysis of C6 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing C6 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19262_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of C6 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing C6 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of ANA-1 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing ANA-1 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19262_FCM7.jpg FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of ANA-1 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing ANA-1 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of A431 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing A431 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19262_FCM6.jpg FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of A431 cells using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Overlay histogram showing A431 cells stained with AAA19262 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262,1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 5. IF analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 4μg/mL rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19262_IF5.jpg IF (Immunofluorescence) (Figure 5. IF analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 4μg/mL rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. DyLight®594 Conjugated Goat Anti-Rabbit IgG (BA1142) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19262_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19262_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19262_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).non-muscle Myosin IIB/MYH10 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-non-muscle Myosin IIB/MYH10 Antibody (AAA19262) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysatesLane 3: mouse NIH/3T3 whole cell lysatesLane 4: human SKOV3 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-non-muscle Myosin IIB/MYH10 antigen affinity purified polyclonal antibody (Catalog # AAA19262) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for non-muscle Myosin IIB/MYH10 at approximately 229KD. The expected band size for non-muscle Myosin IIB/MYH10 is at 229KD.)

product-image-AAA19262_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of non-muscle Myosin IIB/MYH10 using anti-non-muscle Myosin IIB/MYH10 antibody (AAA19262).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysatesLane 2: mouse brain tissue lysatesLane 3: mouse NIH/3T3 whole cell lysatesLane 4: human SKOV3 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-non-muscle Myosin IIB/MYH10 antigen affinity purified polyclonal antibody (Catalog # AAA19262) at 0. 25 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for non-muscle Myosin IIB/MYH10 at approximately 229KD. The expected band size for non-muscle Myosin IIB/MYH10 is at 229KD.)
Related Product Information for anti-MYH10 antibody
This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. Ma, X., Adelstein, R. S. A point mutation in Myh10 causes major defects in heart development and body wall closure. Circ. Cardiovasc. Genet. 7: 257-265, 2014. Note: Erratum: Circ. Cardiovasc. Genet. 7: 570 only, 2014.
2. Tuzovic, L., Yu, L., Zeng, W., Li, X., Lu, H., Lu, H. -M., Gonzalez, K., Chung, W. K. A human de novo mutation in MYH10 phenocopies the loss of function mutation in mice. Rare Dis. 1: e26144, 2013. Note: Electronic Article.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Myosin-10
NCBI Official Synonym Full Names
myosin, heavy chain 10, non-muscle
NCBI Official Symbol
MYH10
NCBI Official Synonym Symbols
NMMHCB; NMMHC-IIB
NCBI Protein Information
myosin-10; nonmuscle myosin heavy chain IIB; nonmuscle myosin II heavy chain-B; cellular myosin heavy chain, type B; myosin heavy chain, nonmuscle type B; myosin, heavy polypeptide 10, non-muscle
UniProt Protein Name
Myosin-10
UniProt Gene Name
MYH10
UniProt Synonym Gene Names
NMMHC-B; NMMHC II-b; NMMHC-IIB
UniProt Entry Name
MYH10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MYH10 myh10 (Catalog #AAA19262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-non-muscle Myosin IIB/MYH10 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's non-muscle Myosin IIB/MYH10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). WB: 0.1-0.25ug/ml|Human, Mouse, Rat| IHC-P: 0.5-1ug/ml|Human, Rat| ICC/IF: 4ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Human, Mouse, Rat|. Researchers should empirically determine the suitability of the MYH10 myh10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "non-muscle Myosin IIB/MYH10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.