Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281032_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using NR2E1 antibody.)

Rabbit anti-Human NR2E1 Polyclonal Antibody | anti-NR2E1 antibody

NR2E1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
NR2E1; TLL; TLX; XTLL
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
NR2E1, Antibody; NR2E1 Polyclonal Antibody; TLL; TLX; XTLL; anti-NR2E1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
Sequence Length
422
Applicable Applications for anti-NR2E1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human NR2E1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using NR2E1 antibody.)

product-image-AAA281032_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using NR2E1 antibody.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NR2E1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281032_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NR2E1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-NR2E1 antibody
The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NR2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 42kDa; 46kDa
Observed: 43kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group E member 1 isoform a
NCBI Official Synonym Full Names
nuclear receptor subfamily 2 group E member 1
NCBI Official Symbol
NR2E1
NCBI Official Synonym Symbols
TLL; TLX; XTLL
NCBI Protein Information
nuclear receptor subfamily 2 group E member 1
UniProt Protein Name
Nuclear receptor subfamily 2 group E member 1
UniProt Gene Name
NR2E1
UniProt Synonym Gene Names
TLX; Tll; hTll

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NR2E1 nr2e1 (Catalog #AAA281032) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR2E1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR2E1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the NR2E1 nr2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YFRGHKEENG AAAHFPSAAL PAPAFFTAVT QLEPHGLELA AVSTTPERQT LVSLAQPTPK YPHEVNGTPM YLYEVATESV CESAARLLFM SIKWAKSVPA FSTLSLQDQL MLLEDAWREL FVLGIAQWAI PVDANTLLAV SGMNGDNTDS QKLNKIISEI QALQEVVARF RQLRLDATEF ACLKCIVTFK AVPTHSGSEL RSFRNAAAIA ALQDEAQLTL NSYIHTRYPT QPCRFGKLLL LLPALRSISP STIEE. It is sometimes possible for the material contained within the vial of "NR2E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.