Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198084_WB10.jpg WB (Western Blot) (Lanes:Lane 1: 50ug HEK293 lysateLane 2: 50ug MDCK lysateLane 3: 50ug NMuMG lysateLane 4: 50ug MDAMB231 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:10,000Gene Name:NUCB2Submitted by:Dr. Mikel Garcia-Marcos, Boston University School of Medicine)

Rabbit NUCB2 Polyclonal Antibody | anti-NUCB2 antibody

NUCB2 antibody - middle region

Gene Names
NUCB2; NEFA; HEL-S-109
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NUCB2, Antibody; NUCB2 antibody - middle region; anti-NUCB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Sequence Length
420
Applicable Applications for anti-NUCB2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NUCB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Lanes:Lane 1: 50ug HEK293 lysateLane 2: 50ug MDCK lysateLane 3: 50ug NMuMG lysateLane 4: 50ug MDAMB231 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:10,000Gene Name:NUCB2Submitted by:Dr. Mikel Garcia-Marcos, Boston University School of Medicine)

product-image-AAA198084_WB10.jpg WB (Western Blot) (Lanes:Lane 1: 50ug HEK293 lysateLane 2: 50ug MDCK lysateLane 3: 50ug NMuMG lysateLane 4: 50ug MDAMB231 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:10,000Gene Name:NUCB2Submitted by:Dr. Mikel Garcia-Marcos, Boston University School of Medicine)

WB (Western Blot)

(Host: RabbitTarget Name: NUCB2Sample Tissue: Human COLO205Antibody Dilution: 1.0ug/ml)

product-image-AAA198084_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NUCB2Sample Tissue: Human COLO205Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: NUCB2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA198084_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: NUCB2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA198084_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-NUCB2 antibody
This is a rabbit polyclonal antibody against NUCB2. It was validated on Western Blot and immunohistochemistry

Target Description: Nucleobindin-2 is a calcium-binding EF-hand protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
nucleobindin-2 isoform 1 preproprotein
NCBI Official Synonym Full Names
nucleobindin 2
NCBI Official Symbol
NUCB2
NCBI Official Synonym Symbols
NEFA; HEL-S-109
NCBI Protein Information
nucleobindin-2
UniProt Protein Name
Nucleobindin-2
UniProt Gene Name
NUCB2
UniProt Synonym Gene Names
NEFA
UniProt Entry Name
NUCB2_HUMAN

Similar Products

Product Notes

The NUCB2 nucb2 (Catalog #AAA198084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUCB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NUCB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NUCB2 nucb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMKEHERREY LKTLNEEKRK EEESKFEEMK KKHENHPKVN HPGSKDQLKE. It is sometimes possible for the material contained within the vial of "NUCB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.