Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197454_WB10.jpg WB (Western Blot) (WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit OLIG2 Polyclonal Antibody | anti-OLIG2 antibody

OLIG2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
OLIG2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
OLIG2, Antibody; OLIG2 antibody - N-terminal region; anti-OLIG2 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Sequence Length
323
Applicable Applications for anti-OLIG2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197454_WB10.jpg WB (Western Blot) (WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: OLIG2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA197454_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: OLIG2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: OLIG2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA197454_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: OLIG2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage CellsDilution: 1:500)

product-image-AAA197454_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage CellsDilution: 1:500)
Related Product Information for anti-OLIG2 antibody
This is a rabbit polyclonal antibody against OLIG2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
oligodendrocyte transcription factor 2
NCBI Official Synonym Full Names
oligodendrocyte transcription factor 2
NCBI Official Symbol
OLIG2
NCBI Official Synonym Symbols
BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19
NCBI Protein Information
oligodendrocyte transcription factor 2
UniProt Protein Name
Oligodendrocyte transcription factor 2
UniProt Gene Name
OLIG2
UniProt Synonym Gene Names
BHLHB1; BHLHE19; PRKCBP2; RACK17; Oligo2; bHLHb1; bHLHe19
UniProt Entry Name
OLIG2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OLIG2 olig2 (Catalog #AAA197454) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OLIG2 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OLIG2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the OLIG2 olig2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSDASLVSS RPSSPEPDDL FLPARSKGSS GSAFTGGTVS SSTPSDCPPE. It is sometimes possible for the material contained within the vial of "OLIG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.