Rabbit ORAI1 Polyclonal Antibody | anti-ORAI1 antibody
ORAI1 antibody - middle region
Gene Names
ORAI1; IMD9; TAM2; ORAT1; CRACM1; TMEM142A
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ORAI1, Antibody; ORAI1 antibody - middle region; anti-ORAI1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Predicted Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP
Applicable Applications for anti-ORAI1 antibody
WB (Western Blot)
Protein Size (# AA)
301 amino acids
Protein Interactions
UBQLN1; UBC; TRPC3; TRPC6;
Blocking Peptide
For anti-ORAI1 (MBS3209798) antibody is Catalog # MBS3234754
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ORAI1
Predicted Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%; Yeast: 77%
Replacement Item
This antibody may replace item sc-377281 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ORAI1 antibody
This is a rabbit polyclonal antibody against ORAI1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction (CRAC-SCID).CRACM1 is a plasma membrane protein essential for store-operated calcium entry (Vig et al., 2006 [PubMed 16645049]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-331 BC075831.1 1-331 332-844 BC013386.1 220-732 845-990 BC075831.1 845-990 991-1490 BG574128.1 52-551 1491-1496 AK027372.1 1235-1240
Target Description: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction (CRAC-SCID).CRACM1 is a plasma membrane protein essential for store-operated calcium entry (Vig et al., 2006 [PubMed 16645049]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-331 BC075831.1 1-331 332-844 BC013386.1 220-732 845-990 BC075831.1 845-990 991-1490 BG574128.1 52-551 1491-1496 AK027372.1 1235-1240
Product Categories/Family for anti-ORAI1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
calcium release-activated calcium channel protein 1
NCBI Official Synonym Full Names
ORAI calcium release-activated calcium modulator 1
NCBI Official Symbol
ORAI1
NCBI Official Synonym Symbols
IMD9; TAM2; ORAT1; CRACM1; TMEM142A
NCBI Protein Information
calcium release-activated calcium channel protein 1
UniProt Protein Name
Calcium release-activated calcium channel protein 1
UniProt Gene Name
ORAI1
UniProt Synonym Gene Names
CRACM1; TMEM142A
UniProt Entry Name
CRCM1_HUMAN
Similar Products
ORAI1 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, Western Blot, ELISA
ORAI1 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, Western Blot, ELISA
Product Notes
The ORAI1 orai1 (Catalog #AAA200066) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ORAI1 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ORAI1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ORAI1 orai1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IGTLLFLAEV VLLCWVKFLP LKKQPGQPRP TSKPPASGAA ANVSTSGITP. It is sometimes possible for the material contained within the vial of "ORAI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
