Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198185_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Rabbit PARN Polyclonal Antibody | anti-PARN antibody

PARN antibody - N-terminal region

Gene Names
Parn; DAN; 1200003I18Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PARN, Antibody; PARN antibody - N-terminal region; anti-PARN antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ
Sequence Length
624
Applicable Applications for anti-PARN antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PARN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

product-image-AAA198185_WB13.jpg WB (Western Blot) (WB Suggested Anti-PARN Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

WB (Western Blot)

(Lanes:Lane 1: 7ug HEK293 cytoplasmic lysate2: 7ug HEK293 nuclei lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:PARNSubmitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)

product-image-AAA198185_WB15.jpg WB (Western Blot) (Lanes:Lane 1: 7ug HEK293 cytoplasmic lysate2: 7ug HEK293 nuclei lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:PARNSubmitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto University)
Related Product Information for anti-PARN antibody
This is a rabbit polyclonal antibody against PARN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PARN is an oligomeric, processive, and cap-interacting 3' exonuclease.
Product Categories/Family for anti-PARN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
poly(A)-specific ribonuclease PARN isoform 1
NCBI Official Synonym Full Names
poly(A)-specific ribonuclease (deadenylation nuclease)
NCBI Official Symbol
Parn
NCBI Official Synonym Symbols
DAN; 1200003I18Rik
NCBI Protein Information
poly(A)-specific ribonuclease PARN
UniProt Protein Name
Poly(A)-specific ribonuclease PARN
UniProt Gene Name
Parn
UniProt Entry Name
PARN_MOUSE

Similar Products

Product Notes

The PARN parn (Catalog #AAA198185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PARN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PARN can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PARN parn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEEADFFAID GEFSGISNGP SVTALTSGFD TPEERYQKLK KHSMDFLLFQ. It is sometimes possible for the material contained within the vial of "PARN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.